KEGG   Burkholderia rhizoxinica: RBRH_03777Help
Entry
RBRH_03777        CDS       T01355                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
brh  Burkholderia rhizoxinica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:brh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1191380..1193122)
Genome map
AA seq 580 aa AA seqDB search
MTLLGIAYPQAQDDWAQKQDWTLVRDPSHRTAGALWHQSEPSTRVLCGRLGTSAYYFYGS
AFSKQDHREIQEGELQAMVAEGPARLMAQCWGRYLFISFDLAAKKLICCSDPSNQWPLYW
AWSNRDGLLFSDTITCLHQTLVERGERPAWNHAFFTTWLRTGTMQSGELPFDRIRELPVG
CALSYTEGRQPQIVTVWDPLKHAIKDDTQTPFDILKHYLNRFVSFSDRPVLELSGGLESS
SVLLAMRAVASADQPLSCAHYYHADVASSNELDHARQVAQHTQAHLQEVNGKALTFAPVQ
SEPPRMAKPSLRYSVLARGQYCASQFERQEHTPLISGHGGDALFLAPPPCSALADAALTG
QWRRLRRMAMDLALMYRAPLMRVAKRAVQSVFASDPSDKVNDTFKLLSEDTQHILFDRRT
CLHPFFQHTQTRLPGKLDQLFMAFLSLDDVRIPAYPFTQPKHYPFLCQPMVEFALSTPSY
DHFEGAHNRIVLRKSVAAATGYPNLWRRNKGETSGIDLLGLRDHREHVMAVCLEGWLAKA
GYIDVARTHDAIQQSSKGNSKHFMDLLHLYAAELFIQSWQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgactctactcggtatcgcctatccccaagcgcaggatgattgggcacaaaaacaggat
tggacgctcgtgcgcgatccgtcccatcggactgcgggcgcgctgtggcatcaatccgag
ccgtccacacgcgttttatgcgggcgcttgggcacgagcgcctactacttttatggttcg
gcgttttcgaaacaagaccatcgcgaaatccaggaaggcgagctccaagcgatggtggcc
gaaggcccagcgcgtctcatggcgcaatgctggggaagatatctctttatcagctttgat
ctggcggccaaaaagctgatctgttgcagcgatccgagtaaccaatggccgttatattgg
gcctggtctaaccgtgacggcttgcttttttcggatacgatcacgtgtttgcatcaaacc
ttggtggagcgcggcgagcggcccgcctggaatcacgccttttttacgacctggttacgt
acgggcaccatgcaaagtggcgagctgccgttcgatcggatccgagagcttccggtaggt
tgcgcgctgtcttatacggagggccgtcagccgcagatcgtgaccgtctgggatccgctc
aagcacgcaatcaaggatgatacgcaaaccccattcgatattttaaagcattatctgaac
cggttcgtctcattcagtgatcggcccgtgctggagctctccggcggcctggaatccagt
tcggtgctgctggcgatgcgcgctgtcgcctcggcagatcagccgctgtcttgcgcgcac
tattatcacgccgatgtggcttcgtccaacgagctggatcatgcccgccaagtggcacag
catactcaggctcacctccaggaggtcaatgggaaggccttaacgtttgctcctgttcag
tcggagccgccacgcatggcgaaaccgagtctgcggtatagcgtgctcgcgcgtggtcag
tattgtgccagtcaatttgagcggcaagagcacaccccactgatcagcgggcatggcggc
gatgcgctctttttggcgccgccgccttgcagcgcgctggccgatgcggcactcaccggg
caatggcggcgacttaggcgcatggcgatggatttggcactcatgtaccgcgcgccgctg
atgcgcgtggccaaacgtgcggtgcaatcggtgtttgctagcgatccttctgacaaggtc
aacgacacctttaagctactctccgaggacacgcagcacatactattcgatcgacggacg
tgcctacacccattctttcagcacacccagactcgcctacccggcaagcttgatcagctg
tttatggcttttttatcgctcgatgatgtcagaattcctgcctatccatttacgcaaccc
aagcactatccgtttctttgccagccgatggtcgagttcgcgctgtcaacgcccagctac
gatcatttcgaaggggcgcacaatcgcattgtgctgagaaaatcggtcgcggccgccacc
ggctacccgaacctatggcgacgcaacaaaggcgagacatcgggcatcgatttgttgggt
cttcgagaccaccgggagcatgtcatggcagtctgtctcgagggatggttggccaaagca
ggctacatcgacgtagcgcgcacccatgacgcgattcagcagagcagtaaggggaacagt
aaacatttcatggacctccttcacctctatgctgccgagctgtttattcaaagttggcaa
taa

DBGET integrated database retrieval system