KEGG   Brachyspira murdochii: Bmur_0087Help
Entry
Bmur_0087         CDS       T01229                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
brm  Brachyspira murdochii
Pathway
brm02020  Two-component system
brm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:brm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bmur_0087
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bmur_0087
Enzymes [BR:brm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bmur_0087
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Bmur_0087
Two-component system [BR:brm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bmur_0087
Bacterial motility proteins [BR:brm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bmur_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Lipase_GDSL
Motif
Other DBs
NCBI-ProteinID: ADG70197
UniProt: D5U4F2
Position
complement(107576..108709)
Genome map
AA seq 377 aa AA seqDB search
MATKIKVLAIDDSALIRQLLTKIVNSDPALEMVGTAANPILAENKVKNLKPDIITLDIEM
PEMDGITYLKKLMLNNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRDGVEEL
ATDLVEKIKNAYANRAKFYRKHGVNIPTETASPVERTPISLEAPKTAGFKVYQKNTADII
LPLTPSRETPMDKIILIGSSTGGTEALIECLKNVTPSAPPIVITQHMPEHFTTSFAKRLN
SILKIDVAESEDCMSIGRGQAVLARGGKHTMIKVKGGKYFIEVRDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEVLPLDKILAAALKRV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaaattaaagtattagctattgatgatagcgcattaattaggcaattacta
acaaaaattgttaactcagatcctgctttagaaatggtgggtactgctgcaaatccaatt
ctagctgaaaataaggtcaaaaatcttaaaccagatattattactttagatattgaaatg
cctgaaatggacggtattacttatcttaaaaaattaatgcttaataaccctattcccgtt
ataatgtttagttctttgttagataaacatagagaattggctttagatgcattaaatata
ggtgcttttgattatgttataaaaccatctgctaatgttagagatggagttgaagaatta
gctactgacctagttgaaaaaattaaaaatgcttatgctaacagagctaaattctacaga
aaacatggtgttaatattcctactgaaacagcttccccagtagaaagaacacctattagt
ttggaagctcctaaaactgcaggatttaaagtttatcaaaaaaatactgctgatattata
cttcctcttactccttcaagagaaactcctatggataaaattatacttataggctcttct
actggaggtactgaggcattaatagaatgtcttaaaaatgttactccttcagctccgcct
atagttataactcagcatatgcctgaacattttactacttcgttcgccaaaagattgaac
agtatattaaaaattgatgtagctgaatcagaagattgtatgagtataggaagaggtcag
gctgttctagcacgcggcggtaagcatactatgattaaagtaaaaggcggtaaatatttt
atagaagttagagacggagagccggttacaagacataaaccttctgtagatgtacttttc
agaagcggtgctgtttatgctaaaaataaagctattggtataatacttactggtatgggt
gatgatggtgctaatggtatgaaagaaatgaaagatgcaggtgcatacaatatagcacaa
aatgaagaaacttgtaccgtatttggtatgcctagagaggctatagcaagaggcggtgta
gatgaagttttacctttagataaaatacttgcagctgctctaaaaagagtataa

DBGET integrated database retrieval system