KEGG   Brachyspira murdochii: Bmur_0348Help
Entry
Bmur_0348         CDS       T01229                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
brm  Brachyspira murdochii
Pathway
brm00010  Glycolysis / Gluconeogenesis
brm00052  Galactose metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01120  Microbial metabolism in diverse environments
brm01130  Biosynthesis of antibiotics
Module
brm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_0348
   00052 Galactose metabolism
    Bmur_0348
Enzymes [BR:brm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bmur_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADG70452
UniProt: D5U5W1
Position
complement(440719..441726)
Genome map
AA seq 335 aa AA seqDB search
MFRSKKENFGKNTYLYTLENDKGLKIKLAEVGATITGIFFKDKNGKEIETAFGSDDIEFY
TDKAKNGHMGATVGRVAGRTIGAKFKIDDKEYHITANKSPDHTHGGVNGLSYVIYNSIQK
KDNEVLFSYVSKDREEGYPGNLNLIVKYTITDENEIIIDYIATTDKTSPLNIMNHSYFNL
NGGGKINDHEIFIDAAYYLGDDENGITSGEILKTKNTPYDFTKSKKIDDIIKSKGGCDNC
FVFDDNDINKQRVKVISKETGISLEVFTTMPSVLFYTANSLNNCKVRNQTLGKHEAFCLE
AQYFSCSLNFNHFPSIMLYPDREYNHRTIYKFGLI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatcaaagaaagaaaattttggtaagaatacatatctatatactttagaaaat
gataagggcttaaaaataaaattggcagaagtaggtgcaactataacaggtatatttttt
aaagataaaaacggcaaggaaatagaaacggcatttggttctgatgatatagagttttat
acagacaaggcaaaaaacggacatatgggtgctactgtaggaagagtggcaggacgtact
attggagctaaatttaaaatagatgataaagagtatcatataacagctaataaatcacca
gatcatactcatggcggtgtaaacggactttcttatgtaatttataattctattcaaaaa
aaagataatgaggtgttattttcttatgtatcaaaagacagagaagaaggttatcccgga
aatcttaatttgatagtaaaatacactataacagatgaaaatgaaataataatagactat
attgccactacagataaaacaagtcctttaaatataatgaatcattcttattttaattta
aacggcggaggaaaaattaatgatcatgaaatatttatagatgccgcttattatttgggt
gatgatgaaaatggtattacttcaggcgagatattaaagactaaaaatactccttatgac
ttcacaaaatcaaaaaaaatagatgatataataaaatcaaaaggcggatgtgataattgt
tttgtatttgatgataatgatataaataaacaaagagtaaaagttatttccaaagaaact
ggtataagtttggaagtatttactacaatgccttctgtacttttttatactgctaattct
cttaataattgcaaagtaagaaatcagactttgggcaaacatgaggctttttgtttggaa
gcacagtatttttcatgctctttaaactttaatcattttccaagcataatgctttatcca
gacagagaatataatcatagaactatatataagttcggattaatataa

DBGET integrated database retrieval system