KEGG   Brachyspira murdochii: Bmur_0353Help
Entry
Bmur_0353         CDS       T01229                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
brm  Brachyspira murdochii
Pathway
brm00260  Glycine, serine and threonine metabolism
brm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01130  Biosynthesis of antibiotics
brm01230  Biosynthesis of amino acids
Module
brm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmur_0353
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmur_0353
Enzymes [BR:brm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bmur_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF2188
Motif
Other DBs
NCBI-ProteinID: ADG70457
UniProt: D5U5W6
Position
complement(446359..447612)
Genome map
AA seq 417 aa AA seqDB search
MKNSNKGFFGKFGGRFVPEALEKLLIELEEAFAHYINDKEFLSELEELRADFIGRPTPLM
YAKNLSEKIGGAKIYVKLEGLANTGAHKINNSIGQALLAKKMGKKKIIAETGAGQHGLAT
AAACAKLGLECSIYMGEIDVKRQQPNVASMELYGANVVSVTRGGRGLKDAVDAALEDWVK
DLKDTHYLLGSAVGPSPYPDIVRTFQSVIGRELEKQIEQKNLNVKAMIACVGGGSNAIGF
FEPFIERENPKLIAVEAGGISMNLGENAIRMQNPYAKDVAAQGYMSKFILKENGEISETM
SISAGLDYPGVGPQLAYLGEAGRIEFTYATDKEAINAVKEFARNEGVIFALESAHAGAKA
IEYAKQYTKDDVIIVNMSGRGDKDIFITSPIFRADKWKEFLKSELERLEKNIDIHKF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagtaataaaggattcttcggtaaattcggcggtagatttgtaccagaagca
ttagaaaaattattaattgaattggaagaagcatttgcacattatattaatgacaaagag
tttttaagcgagcttgaggaattaagagctgattttataggaagacctactcctttaatg
tatgctaaaaacctatcagaaaaaataggcggtgctaaaatctatgtaaaacttgaaggc
ttagcaaatacaggtgcacataagattaacaattcaataggacaggcacttttagccaag
aagatgggaaagaaaaagattattgcagaaacaggtgcaggtcagcatggacttgccacc
gctgcagcatgtgcaaaattaggacttgaatgttctatatatatgggtgagatagatgta
aaaagacagcagcctaatgtagcttcaatggaattgtacggagctaatgtagtgtcagtt
acaaggggaggaagaggacttaaagatgctgttgatgcggcattagaagattgggttaaa
gatttaaaagatacccactatttgcttggaagtgcagtaggacctagtccttatcctgat
attgtcagaactttccaatcggtaataggaagagaattagaaaaacaaatagaacagaaa
aatttgaatgttaaagctatgatagcatgcgtaggcggcggttctaatgctataggattt
tttgagccttttatagaaagagaaaatccaaaattaatagcagttgaagcaggcggtata
agtatgaatcttggagaaaatgctattagaatgcaaaacccttatgctaaagatgtagca
gctcagggatatatgagtaagtttatattaaaagaaaacggtgaaatatcggaaactatg
tctatatctgctggtttggactatcccggtgtaggtcctcagcttgcatatttgggagaa
gctggaagaatagagtttacttatgctactgataaagaggctattaatgctgttaaagag
tttgcaagaaatgagggagtaatatttgcattagaaagtgcacatgcaggtgctaaagct
atagaatatgccaaacaatacacaaaagatgatgtaattatagttaatatgtctggaaga
ggagataaagatatatttataacttctccaatatttagagctgataaatggaaagaattt
ttaaaaagtgaattagaaagattagaaaaaaacatagatattcacaaattttag

DBGET integrated database retrieval system