KEGG   Brachyspira murdochii: Bmur_0592Help
Entry
Bmur_0592         CDS       T01229                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
brm  Brachyspira murdochii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bmur_0592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmur_0592
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bmur_0592
Enzymes [BR:brm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bmur_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
717407..718462
Genome map
AA seq 351 aa AA seqDB search
MKTWNGLLREYKEYLPITDKTPLITLNEGNTPLIKAEKIGKELGGIELYFKYDGLNPTGS
FKDRGMVMAVAKALEEGSKAIMCASTGNTSASAAAYAARSGIQCIVVIPDGNIALGKLAQ
ALMYGAKVIAIKGNFDEALKAVVDITNKYPITLVNSINPFRLQGQKTSAFEICDALGKAP
DYLAIPVGNAGNISAYWMGFKEYKENGKVSNLPKMIGFEAEGCAAIVQNKVIENPQTIAT
AIKIGNPASWKLAVNASNESNGFIDSVTDDEILEAYKMLTREEGIFAEPASAASLAGVIK
TYKAGKLNKGDTVVSVLTGNGLKDPDNAIKICSAPIKVDNNIEEIRKAIGI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatggaacggacttttaagagagtataaagaatatctgcctattacagataaa
accccgcttattacattaaatgagggaaatactccattaataaaggctgaaaaaatagga
aaagaacttggaggaatagaattatattttaaatatgacggtcttaatcctacaggatca
ttcaaagacagaggaatggtaatggcagttgctaaagcacttgaagaaggttcaaaagct
attatgtgtgcttctactggaaatacttccgcatcagctgctgcttatgctgcaagaagc
ggtattcaatgtatagtagttataccagatggtaatattgctttgggaaaattggctcag
gctttgatgtacggagctaaggttatagctattaaaggaaattttgatgaagccttaaaa
gctgttgttgatattacaaataaatatcctattacattagtaaactcaattaaccctttc
agacttcagggacaaaaaacttctgcatttgaaatttgcgatgcattaggaaaagctcct
gattatttggctatacctgttggaaatgctggaaatatatctgcttattggatgggtttt
aaagaatataaagaaaatggaaaagtatcaaacttacctaaaatgataggttttgaggct
gaaggctgtgccgctatagtacaaaataaagtaatagaaaatcctcaaactattgctaca
gctataaaaatcggtaatcctgcaagctggaaattagcggttaatgcttctaatgaatca
aacggatttatagattctgttacagatgatgaaatattagaggcttataaaatgctcaca
agagaagaaggaatatttgctgaacctgcttctgctgcttctcttgctggagttataaaa
acttacaaggctggaaaattaaacaaaggcgatactgtagtttctgtacttacaggtaat
ggacttaaagaccctgataatgctataaaaatttgctctgctcctataaaagttgataac
aatatagaagaaataaggaaagctataggaatataa

DBGET integrated database retrieval system