KEGG   Brachyspira murdochii: Bmur_0664Help
Entry
Bmur_0664         CDS       T01229                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
brm  Brachyspira murdochii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:brm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bmur_0664
DNA repair and recombination proteins [BR:brm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bmur_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(796977..797588)
Genome map
AA seq 203 aa AA seqDB search
MNLNNIQSLDKLTQIISRLPGIGGRTAMRLALYLFDCDEEYLKEFADTLYTLHDNIKLCS
KCYSLSDNDICYICSNDKREHNKICVVETYPDMLAIEKTEEYNGVYHVLGGLIAPLKGIG
ISDIRIKELIERVNTENIDEIMIAFSASLEADTTAGYIFKLLKDNNYTGRVTRITYGISL
SSDIENADSRSLARSILDRVEMS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaataatatacagtcattggataaacttactcagattatatcaaggcttccg
ggaataggcggcagaactgctatgcgtcttgctttatatttatttgactgtgatgaagag
tatttaaaagagtttgctgatacattatatactctccatgacaatataaaattatgcagt
aaatgttatagtttgagtgataatgatatttgttatatatgttctaatgataaaagagag
cataataaaatatgtgttgtagagacttatccagatatgcttgcaatagaaaaaacagaa
gagtataacggagtgtatcatgtattaggcggtcttatagcacctcttaaaggtataggt
ataagtgatataaggataaaagagcttattgagagagttaatactgaaaatattgatgaa
ataatgatagctttcagtgcctcattagaagcggatactacagcaggatatatattcaaa
ttattaaaagataataattatacaggcagagtaacaagaattacttatggaatatctttg
tcaagtgatatagaaaatgccgattctaggtctcttgcaagaagtattttagacagggta
gaaatgagttaa

DBGET integrated database retrieval system