KEGG   Brachyspira murdochii: Bmur_0682Help
Entry
Bmur_0682         CDS       T01229                                 

Definition
glycoside hydrolase 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
brm  Brachyspira murdochii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_0682
Enzymes [BR:brm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Bmur_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(813792..815177)
Genome map
AA seq 461 aa AA seqDB search
MKQYKFSDNFLFGSSTSGSQSEGFYNKTNKNIWDYWFEISKEKFHNQVGPEYTSNFFRDY
KDDIKLIKETGHNVFRTSIQWSRIVKDFNTLELDETAVEFYNNVIDELIKNDIEPIICLY
HFDMPLKLQEIGGFENREVVELYAKYASKMFDLYGDKVHKWFTFNEPIVVAEGGYLYKFH
YPEVVSFKRAVQVVYNMNLASAKAVKAFKESGKKGDIGIILNLTPSYPRDENNKEDLNAS
HICDLIFNRSFLDPAVKGEFPSDLIDFVNENNLTPIYEEGDKDILRENTISILGINYYQP
RRVKARESKFESDTLMPENFFEPYEMPNRLMNPYRGWEIYYKGIYDIAKNIQENYSNKKW
LITENGMGVENEERFIKNGIVEDDYRIEFVSEHLKWLHKGIEEGSNCIGYLMWTPIDCWS
WLNAYKNRYGFIRFDLESGKKTIKKSGYWFKELVKNKGFEG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatataaatttagtgataattttttatttgggagttctacttcaggatctcaa
agcgaaggtttttataataagactaataaaaatatatgggattattggtttgaaatatca
aaagaaaaattccataatcaagtaggacctgaatatacatctaatttttttagagattat
aaagatgatataaaattaataaaagaaacaggacataatgtttttagaacttcaatacaa
tggagcagaatagtaaaagattttaatactttagaattagatgaaacagctgttgagttt
tataataatgttatagatgagcttataaaaaatgatatagagcctataatatgtttgtat
cattttgatatgcctttaaaacttcaggagataggaggatttgaaaatagagaagtagtt
gaactttatgcaaaatatgcttctaaaatgtttgatctttatggagataaagttcataaa
tggtttacttttaatgagcctatagtagttgctgagggcggatatttgtataaatttcat
tatccagaagttgtatcatttaaaagagcggttcaggttgtttataatatgaacttggca
agtgcaaaggctgtaaaagcttttaaagaatctggtaaaaaaggtgatataggtataata
cttaatcttactccttcatatcctagagatgaaaataataaagaagatttaaatgcttct
catatatgcgatttgatttttaatagaagttttttggatcctgctgttaagggagagttt
ccatctgatttgatagactttgtaaatgaaaataatcttactcctatatatgaagaaggt
gataaggatatattaagagaaaatactatatcgattttaggaataaattattatcagcct
agaagagtaaaagcaagagagagtaagtttgaatcggatactttaatgcctgaaaatttc
tttgagccttatgagatgcccaacagacttatgaatccttacagaggctgggaaatatat
tataaaggtatttatgatatagctaaaaatatacaggaaaactattccaataaaaaatgg
cttatcacagaaaacggtatgggtgtggaaaacgaagaaagatttataaaaaacggtatt
gttgaagatgattacagaatagagtttgtaagtgagcatttgaaatggcttcacaagggt
atagaagaaggttctaattgtataggttatttgatgtggactcctatagactgctggtct
tggcttaatgcttataaaaacagatacggatttataaggtttgatttagaaagcggtaaa
aagacaataaaaaaatcaggctattggtttaaagagctagtgaaaaacaagggctttgag
ggatag

DBGET integrated database retrieval system