KEGG   Brachyspira murdochii: Bmur_0875Help
Entry
Bmur_0875         CDS       T01229                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brm  Brachyspira murdochii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmur_0875
   01230 Biosynthesis of amino acids
    Bmur_0875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_0875
   00051 Fructose and mannose metabolism
    Bmur_0875
   00562 Inositol phosphate metabolism
    Bmur_0875
Enzymes [BR:brm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bmur_0875
Exosome [BR:brm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bmur_0875
  Exosomal proteins of bladder cancer cells
   Bmur_0875
  Exosomal proteins of melanoma cells
   Bmur_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1036743..1037504)
Genome map
AA seq 253 aa AA seqDB search
MARRKLIAGNWKMNNSNKEALELVNQLKNLVKDVKDRDIMIAPTFTCLSDVHNAVKGSNI
KLGAQNLYFEEKGAFTGQISADMLLAVGCEYVIVGHSECRDIFGEKDELINKKVKRALDK
NLIPVLCVGEHLEEREKGITSDIVSSQTKEAFKGLSEAEAKKVVIAYEPVWAIGTGKTAT
PQDADEVHKTIRETLKSLYNESVAEGMIILYGGSVNEKNADDLLNMPNIDGALVGGASLV
ADKFARIVNYIAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctagaagaaaacttattgctggtaactggaaaatgaataattctaataaagaagct
ttggaattagttaatcagttaaagaatttagttaaagatgttaaagacagagatattatg
atagctccaacatttacttgtttaagtgatgtacataatgctgttaaaggaagtaatata
aaattgggagctcagaatttatattttgaagagaaaggtgcttttactggtcaaatttct
gctgatatgcttttggctgtaggatgcgaatatgttattgtaggacactctgaatgcaga
gatattttcggtgagaaagatgaacttattaataaaaaagtaaaaagagctttagataaa
aatctaatacctgttttatgcgtaggcgagcatttagaagaaagagaaaaaggaattact
tctgatatagtaagcagtcaaactaaagaagcattcaaaggtttaagcgaagctgaagct
aaaaaagttgttatagcatacgaacctgtttgggccattggtactggcaaaacagctact
cctcaggacgctgatgaagtgcataaaactataagagaaactttaaaatctctttataat
gaaagcgttgccgaaggaatgattatactttacggcggaagtgttaatgaaaaaaatgct
gatgatttgcttaatatgcctaatatagacggtgctttggttggaggagcttcattagta
gctgataaattcgctagaatagttaattatattgctaaataa

DBGET integrated database retrieval system