KEGG   Brachyspira murdochii: Bmur_0951Help
Entry
Bmur_0951         CDS       T01229                                 

Definition
glycoside hydrolase 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
brm  Brachyspira murdochii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bmur_0951
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bmur_0951
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bmur_0951
Enzymes [BR:brm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bmur_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1120951..1123176
Genome map
AA seq 741 aa AA seqDB search
MREIINFNTNWQFFKEWNDAIKTEKLNAESVTLPHTVSEIPLHYFDESDTWLITGYQNIF
NYDKAKFQNKRILINFEGAMAAAEVFVNNKSFSEHKGGYLPFVHDITDALKEGENIIAVK
LDSLERDDIPPFGNEIDYLCYGGIYREVQIIIVDDISIENIMITGLGNQNITGKIRIRNS
KKTNSKETVSINLYNREYHICEIKKDIQLQNNELFTDIEIDEHIDSDRIELWTINNPRLY
KLEVSLSNEDSTSVRIGFRDVKFTEDGFYLNGEKIKLRGLNRHQSFPYVGYAMPERIQKK
DADILKFDMGLNIVRSSHYPASRHFLDRCDEIGLMVFEEIPGWQHIGDKEWQKVSIENVK
DMIERDFHHASIIIWGVRINESQDNHNFYKETNEMAHKLDKTRQTGGVRYIVGSELLEDV
YTVNDFNYDGKADPIRAQKCITKLDKNVPYMITEYNGHMFPTKMQDCEERTIEHTKRHYE
IINAVAIDKYLAGSTGWCAFDYHTHYNFGSGDRICYHGVYDMFRNPKLAASAYSSQMCKD
YKIVLEPITIYARGERAIGGVSPLMISTNCDYIEIYHENDLIVKEYPAAGKYQGLKHAPV
IVNMAVNIPGVSDMDWADIKIVGYIDSKPVIEKSYLKNPTFKELEVKADDYEINSISEGS
SWDSTRITVKAVDALGNRLPYINEAVKIKVEGEGELIGNDNPVLEGGYYSFWVKSNSKKG
EIKINVSNKRVETKTISIKVN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagagagataataaattttaataccaattggcaattttttaaagaatggaatgatgct
ataaaaacagaaaaactaaatgctgaaagtgtaacactgcctcatacagtttcagaaata
ccattacactattttgatgaatcagatacttggcttattactggatatcaaaatatattt
aattatgataaagccaaatttcaaaataaaagaatattaattaattttgaaggggcaatg
gctgccgctgaagtatttgttaataacaaaagtttttcagagcataaaggcggatattta
ccttttgtacatgatataacagatgcattaaaagaaggggaaaatataatagctgtaaaa
ttagacagtttagaaagagatgatatacctccttttggaaatgaaatagattacctatgc
tatggcggtatatatagagaagttcagataataatagttgatgatatttctatagaaaat
attatgataactggtcttggcaatcaaaatataactggaaaaataagaataagaaacagc
aaaaaaacaaattcaaaagaaactgtctctattaatctttataatagagaatatcatata
tgcgaaataaaaaaagatattcaactacaaaataatgaactatttacagacattgagatt
gatgaacatatagattccgacagaatagagctttggactattaataatcctagactttat
aaattggaagtttcactttctaatgaagacagcacttctgtaagaataggcttcagagat
gttaagttcacagaagatggtttctatttaaacggagaaaaaataaaattaagaggttta
aatagacatcagagtttcccttatgtcggttatgctatgccggaaagaatacagaaaaaa
gatgcggatatattaaaatttgatatgggacttaatattgtacgttcttcgcattatcct
gcttcaagacactttttagacagatgcgatgaaataggattaatggtttttgaagaaata
ccgggctggcagcatataggcgataaagaatggcagaaagtttctatagaaaatgtaaaa
gatatgatagaaagagattttcatcatgcttctataataatttggggagtaagaataaat
gaaagtcaggacaatcataatttctacaaagaaacaaatgaaatggctcataaacttgat
aaaacaagacaaacaggcggagtaagatatatagtaggaagtgagcttttagaagacgta
tatacagttaatgatttcaattatgacggcaaagctgaccctataagagcacaaaaatgc
ataacaaaattagataaaaatgttccttacatgataacagagtataacggacatatgttc
cctacaaaaatgcaggactgcgaagagagaactatagaacatactaaaagacattatgaa
attattaatgctgttgcaatagataaatatttagcaggttccacaggctggtgtgccttt
gattatcatacgcattataactttggttcaggagatagaatatgttatcatggtgtttat
gatatgtttagaaatcctaaattggcagcaagtgcttattcatcacaaatgtgcaaagac
tacaaaatagtattagaacctataacaatatatgcaagaggggaaagagctataggagga
gtttctcctttaatgatttctacaaactgcgactatatagaaatatatcatgaaaatgat
ttgatagtaaaagaatatccagcagcaggaaaatatcaaggattaaaacatgctcctgta
attgtaaatatggctgttaatataccgggtgtaagcgatatggactgggcagatataaaa
attgttggatatatagattcaaaacctgttatagaaaaaagctatttaaaaaatcctact
ttcaaagaacttgaagtaaaagctgatgattatgaaattaattctataagtgaaggttca
tcttgggactcgactagaattactgtaaaagcagttgatgctttaggaaatagacttcca
tatattaatgaagctgtaaaaataaaggttgaaggcgaaggcgaacttataggaaatgac
aacccagtactagaaggcggttattattctttctgggttaaatctaacagcaaaaaggga
gaaataaaaattaatgtatcaaataaaagagttgaaacaaaaactatatcaataaaagta
aattaa

DBGET integrated database retrieval system