KEGG   Brachyspira murdochii: Bmur_1242Help
Entry
Bmur_1242         CDS       T01229                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
brm  Brachyspira murdochii
Pathway
brm00220  Arginine biosynthesis
brm00330  Arginine and proline metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01130  Biosynthesis of antibiotics
brm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Bmur_1242
   00330 Arginine and proline metabolism
    Bmur_1242
Enzymes [BR:brm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bmur_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADG71336
UniProt: D5U9G3
Position
complement(1446386..1447252)
Genome map
AA seq 288 aa AA seqDB search
MSQTLRLVYPQWQGGIISHWIKELKPEDSSRGYYLGAKLLSILAPENNTHKTIEVPVSLN
IEKREVKNGIMDYDYIVKQTNSALDILNKNNPDKIIVFGGECSVSAAPFTYLNKKYNNDI
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGKIDAINNLPSKISSENILFLGLRDWERE
EIRIRQKEYGIKHFAPEEISKSSECIIKWLKECKASKVFIHFDLDVLDPNEIIAAVGVSP
NGMKINEAVRVINDIAGEKELAGLTIAEHMPRVEILMKNMMAELPLFN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaactttaaggttagtttatccgcagtggcagggcggtataatatcgcattgg
ataaaggagttaaaacctgaagattcttcaagaggctattatttaggagctaaactttta
agtatattagcaccagaaaataatactcataaaactatagaagttcctgtttctcttaat
atagaaaaaagagaagtaaaaaatggtattatggattatgattatatagtaaaacaaact
aatagtgccttagatatactaaataaaaataatcctgataaaataatagtttttggagga
gaatgttctgtaagtgctgctccttttacatatttaaacaaaaaatataataatgatata
gctttgatatggatagacgctcaccctgatataactttacctgaagacaatacttatgca
ggatatcatgctatggctgtaagtgcctgcatgggtaaaatagatgctataaataatctt
ccaagtaaaatttcatcagagaatattttatttttaggacttagagactgggaaagagag
gagataaggattcgtcaaaaagagtatggcataaagcattttgctcctgaagagatttct
aagtcaagcgaatgtataataaaatggcttaaagaatgcaaggctagtaaagtattcata
cattttgatttagatgttcttgatcctaatgaaataatagcggctgtcggtgtttctcca
aatggaatgaaaattaatgaggctgttagggttataaatgatatagcaggagaaaaagaa
ttggcaggtcttactatagccgagcatatgccaagggtagaaatacttatgaaaaatatg
atggctgagctgcctttatttaattag

DBGET integrated database retrieval system