KEGG   Brachyspira murdochii: Bmur_1403Help
Entry
Bmur_1403         CDS       T01229                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
brm  Brachyspira murdochii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmur_1403
   01230 Biosynthesis of amino acids
    Bmur_1403
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_1403
  Energy metabolism
   00680 Methane metabolism
    Bmur_1403
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmur_1403
Enzymes [BR:brm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bmur_1403
Exosome [BR:brm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bmur_1403
  Exosomal proteins of melanoma cells
   Bmur_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1606994..1607740)
Genome map
AA seq 248 aa AA seqDB search
MTKVVLIRHGESVWNKENLFTGWADVTLSEKGIEEAKAGGAELKKAGFTFDKAYTSTLTR
AIKTLNLVLEEMGLLWIPVEKCWQLNERHYGALQGLNKSQTAEKYGEDQVKIWRRSYDTP
PPALTKDDERYPGHDPRYKNLSEKELPLTECLKDTVARVVPFWENVILPDIKAGKKIIIA
AHGNSLRALVKYLDNISDADITELNIPTGMPLVYELDDNFKAVNKQYLGDPEAVKKAMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttgttttaatacgtcatggtgagagcgtatggaataaagaaaatttattt
acaggctgggcagatgtaactttgtctgaaaaaggtatagaagaagctaaagcaggcgga
gcagaacttaaaaaagcaggatttacttttgataaagcatatacttctactttaacacgt
gctatcaaaactttaaatctagttttagaagaaatgggacttttatggataccagtagag
aaatgctggcagttaaatgaaagacattacggagcattacaaggcttaaataaatcgcaa
acagctgaaaaatacggagaggatcaggtaaaaatctggagaagaagctatgatactccg
cctccagctttgacaaaagatgatgaaagatatccgggtcatgatccgcgttataaaaac
ttatcagaaaaagaactccctttaacagaatgtttaaaagatactgtggcaagagtagta
cctttttgggaaaatgttatacttccggatattaaagctggaaaaaaaatcatcatagca
gcacatggaaacagtttaagagcattagtaaaatatttagacaatatctctgatgctgac
attacagagcttaatatacctactggaatgcctttagtttatgagcttgatgataatttt
aaagctgtaaacaaacagtatttaggcgaccctgaagctgttaaaaaagctatggaagca
gtagctaatcaaggtaaaaagaagtaa

DBGET integrated database retrieval system