KEGG   Brachyspira murdochii: Bmur_1480Help
Entry
Bmur_1480         CDS       T01229                                 

Definition
NAD-dependent DNA ligase (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
brm  Brachyspira murdochii
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:brm03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:brm03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:brm03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:brm03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1685564..1687555)
Genome map
AA seq 663 aa AA seqDB search
MNKEEAKQKIKQLTETINYHNKLYYTDDNPEIEDYEYDKLFRELENLEREFPELKKDDSP
TNKVGGTILEKFEKFEHPIAMYSLSNVMNEEEFLDFDNRMQRELDASNIKYTVENKFDGL
ALELIYEKGKLTVASTRGDGQVGENVTNNVKMMSNVPKSIKEKNKLIVRGEALITKKDFE
ALNKEREELEEIPFANARNAASGGLRQLDSAESKKRRLKFFAYQIANYKDFDLTNEYKSM
EFLSDLGFTVEGVHPNIDAKKVLETYYDIQEKRSKMDYEIDGLVIKVDDVKYQEKLGFLS
RAPRFAVAFKFKPEEKETVLKNIEVQVGRTGALTPVAKLEPVQVGGVTVSNVTLHNPNEI
KSKDIRIGDTVVVIRSGDVIPKITRVVLEKRPEDSKPFEFPKKCPVCGGDTAVTDGDVIV
RCINEECPSKITRYIEYFVSKPAMNMERIGKEWIAVFTKSGLVKTPADLYKITRDDLFKF
ERMGDKLASYMLESIENSKNTTLKRFIYALGIRQVGETTADLLAKYFTSIENFKKAAIED
LQNIEGIGEISAKSIYDFLHNERTLKLIDDLLAAGVNPVFEKVVTVESPLTGKNVVITGS
IEGFTRTSAKEAAERLGAAVQSAVSKNTDILIVGEKAGSKLKKAQDLGIAIMEADEFIKL
ANS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaagaagctaaacaaaaaataaaacaattaacagaaactattaattaccat
aataaactttattatacagatgataaccctgaaatagaagattatgaatacgataaactt
tttagagaattagaaaatcttgaaagagagtttccagaattaaaaaaagatgacagtcct
acaaataaggttggaggcactatattagaaaagtttgaaaagtttgaacacccaattgca
atgtactctctttctaatgttatgaacgaagaggagtttttggactttgataatagaatg
caaagagagcttgatgctagtaatattaaatacaccgtagaaaataaatttgacggactt
gctttagagcttatttatgaaaaaggaaaactcacagtagcaagcacaagaggagacgga
caagttggagagaatgttaccaataatgttaagatgatgagcaatgttcctaaaagcata
aaagaaaaaaataaactcattgtaagaggcgaagcattaataacaaaaaaagattttgaa
gcattaaataaagaaagagaagagcttgaagagataccttttgccaatgcaagaaatgct
gcctcaggcggattaagacaattagacagtgcagaaagtaaaaaaagaagattaaaattc
tttgcatatcaaatagctaattataaagattttgatttaactaatgaatataaatcaatg
gagtttttatccgatttaggttttacagtggaaggagtacatccaaatattgacgctaaa
aaagtattagaaacttattatgatatacaggaaaaaagaagcaaaatggattatgagatt
gacgggcttgtaataaaagttgatgatgtgaaatatcaggagaaattgggatttttatca
cgtgctccaagatttgcagtagcttttaaattcaaacccgaagagaaagaaacagtttta
aagaatattgaagtgcaggttggacgaactggagcattaacaccagttgccaaattagag
cctgttcaagttggaggcgttactgtttctaatgttacacttcataatcctaatgaaata
aaatcaaaagatataagaatcggagatactgttgtagttatacgttccggcgatgttata
ccgaagattacaagagtagtattagaaaagcgtcctgaagacagcaaaccttttgagttt
cctaaaaaatgtcctgtatgcggtggtgatactgctgtaactgacggcgatgtaatagta
agatgtatcaatgaagagtgtccaagtaagataacaagatatatagagtatttcgtttca
aagcctgctatgaatatggagcgaataggcaaagaatggattgctgtatttacaaaaagc
ggacttgtaaaaactccagcagatctttacaaaataacaagagatgatttatttaagttt
gaaagaatgggagataaattagcaagctacatgctcgaatccattgaaaatagtaaaaac
actaccttaaaaagatttatatatgcattgggtattcgtcaggttggtgaaactactgcg
gacttacttgctaaatattttacttctatagagaatttcaaaaaagctgctattgaagac
ttacaaaatatagaaggtataggcgaaataagtgctaaaagtatttacgacttccttcat
aatgaaagaacattaaagttaatagatgatttacttgcagcaggagttaatccagtattt
gaaaaagtagtaacagtggaatcgcctcttaccggaaagaatgttgtaataacaggctca
atagaaggttttacaagaacttcggcaaaagaggcggctgaaagattgggagctgctgtt
cagtcggcagtatcaaaaaatactgatattttaatagtaggtgagaaagctggaagcaaa
ctaaaaaaagctcaggatttaggtatagcaataatggaagccgatgagtttataaagctt
gctaatagctaa

DBGET integrated database retrieval system