KEGG   Brachyspira murdochii: Bmur_1480Help
Entry
Bmur_1480         CDS       T01229                                 

Definition
NAD-dependent DNA ligase (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
brm  Brachyspira murdochii
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:brm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Bmur_1480
   03410 Base excision repair
    Bmur_1480
   03420 Nucleotide excision repair
    Bmur_1480
   03430 Mismatch repair
    Bmur_1480
Enzymes [BR:brm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Bmur_1480
DNA replication proteins [BR:brm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Bmur_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1685564..1687555)
Genome map
AA seq 663 aa AA seqDB search
MNKEEAKQKIKQLTETINYHNKLYYTDDNPEIEDYEYDKLFRELENLEREFPELKKDDSP
TNKVGGTILEKFEKFEHPIAMYSLSNVMNEEEFLDFDNRMQRELDASNIKYTVENKFDGL
ALELIYEKGKLTVASTRGDGQVGENVTNNVKMMSNVPKSIKEKNKLIVRGEALITKKDFE
ALNKEREELEEIPFANARNAASGGLRQLDSAESKKRRLKFFAYQIANYKDFDLTNEYKSM
EFLSDLGFTVEGVHPNIDAKKVLETYYDIQEKRSKMDYEIDGLVIKVDDVKYQEKLGFLS
RAPRFAVAFKFKPEEKETVLKNIEVQVGRTGALTPVAKLEPVQVGGVTVSNVTLHNPNEI
KSKDIRIGDTVVVIRSGDVIPKITRVVLEKRPEDSKPFEFPKKCPVCGGDTAVTDGDVIV
RCINEECPSKITRYIEYFVSKPAMNMERIGKEWIAVFTKSGLVKTPADLYKITRDDLFKF
ERMGDKLASYMLESIENSKNTTLKRFIYALGIRQVGETTADLLAKYFTSIENFKKAAIED
LQNIEGIGEISAKSIYDFLHNERTLKLIDDLLAAGVNPVFEKVVTVESPLTGKNVVITGS
IEGFTRTSAKEAAERLGAAVQSAVSKNTDILIVGEKAGSKLKKAQDLGIAIMEADEFIKL
ANS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaagaagctaaacaaaaaataaaacaattaacagaaactattaattaccat
aataaactttattatacagatgataaccctgaaatagaagattatgaatacgataaactt
tttagagaattagaaaatcttgaaagagagtttccagaattaaaaaaagatgacagtcct
acaaataaggttggaggcactatattagaaaagtttgaaaagtttgaacacccaattgca
atgtactctctttctaatgttatgaacgaagaggagtttttggactttgataatagaatg
caaagagagcttgatgctagtaatattaaatacaccgtagaaaataaatttgacggactt
gctttagagcttatttatgaaaaaggaaaactcacagtagcaagcacaagaggagacgga
caagttggagagaatgttaccaataatgttaagatgatgagcaatgttcctaaaagcata
aaagaaaaaaataaactcattgtaagaggcgaagcattaataacaaaaaaagattttgaa
gcattaaataaagaaagagaagagcttgaagagataccttttgccaatgcaagaaatgct
gcctcaggcggattaagacaattagacagtgcagaaagtaaaaaaagaagattaaaattc
tttgcatatcaaatagctaattataaagattttgatttaactaatgaatataaatcaatg
gagtttttatccgatttaggttttacagtggaaggagtacatccaaatattgacgctaaa
aaagtattagaaacttattatgatatacaggaaaaaagaagcaaaatggattatgagatt
gacgggcttgtaataaaagttgatgatgtgaaatatcaggagaaattgggatttttatca
cgtgctccaagatttgcagtagcttttaaattcaaacccgaagagaaagaaacagtttta
aagaatattgaagtgcaggttggacgaactggagcattaacaccagttgccaaattagag
cctgttcaagttggaggcgttactgtttctaatgttacacttcataatcctaatgaaata
aaatcaaaagatataagaatcggagatactgttgtagttatacgttccggcgatgttata
ccgaagattacaagagtagtattagaaaagcgtcctgaagacagcaaaccttttgagttt
cctaaaaaatgtcctgtatgcggtggtgatactgctgtaactgacggcgatgtaatagta
agatgtatcaatgaagagtgtccaagtaagataacaagatatatagagtatttcgtttca
aagcctgctatgaatatggagcgaataggcaaagaatggattgctgtatttacaaaaagc
ggacttgtaaaaactccagcagatctttacaaaataacaagagatgatttatttaagttt
gaaagaatgggagataaattagcaagctacatgctcgaatccattgaaaatagtaaaaac
actaccttaaaaagatttatatatgcattgggtattcgtcaggttggtgaaactactgcg
gacttacttgctaaatattttacttctatagagaatttcaaaaaagctgctattgaagac
ttacaaaatatagaaggtataggcgaaataagtgctaaaagtatttacgacttccttcat
aatgaaagaacattaaagttaatagatgatttacttgcagcaggagttaatccagtattt
gaaaaagtagtaacagtggaatcgcctcttaccggaaagaatgttgtaataacaggctca
atagaaggttttacaagaacttcggcaaaagaggcggctgaaagattgggagctgctgtt
cagtcggcagtatcaaaaaatactgatattttaatagtaggtgagaaagctggaagcaaa
ctaaaaaaagctcaggatttaggtatagcaataatggaagccgatgagtttataaagctt
gctaatagctaa

DBGET integrated database retrieval system