KEGG   Brachyspira murdochii: Bmur_1768Help
Entry
Bmur_1768         CDS       T01229                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
brm  Brachyspira murdochii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmur_1768
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_1768
   00020 Citrate cycle (TCA cycle)
    Bmur_1768
   00620 Pyruvate metabolism
    Bmur_1768
   00640 Propanoate metabolism
    Bmur_1768
   00650 Butanoate metabolism
    Bmur_1768
  Energy metabolism
   00680 Methane metabolism
    Bmur_1768
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bmur_1768
Enzymes [BR:brm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bmur_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2019029..2021293)
Genome map
AA seq 754 aa AA seqDB search
MANKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGAATAGGRVFNATSANGLLFAMEQLPVQSGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNIFALKIAERAKLPIIVSSDGFFTSH
QKKKIHLFKNDKDVQDFLGKYTPEVTSVEPGKNPVTIGPYMNEDELTGSKLQLSQALEDA
RAIILDVFEEFASFSGRKYSPIETYNMEDAEVALMLCGSAYETGTLAVDEMRKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDSYSGMGGNMSTEIRAALKNDPNNKSSI
VSRVYGLGGTEFTLEKAKELFDLGLKELANPGSVEKHSYLEQYMGDPNVKMKPIHEPLTL
ESQKSGITVTMNEQTHKLEVKTPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
EVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGIVEMYHERKRRGEIEGPED
PTFIMVTGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPLGHRTSTSN
VGKAEVGKQFNHKDVAQIFAGCHIPYVATGCEAYPLDLVKKAAKAQWYANHHGTAFVKLL
IACPLNWKSPDDMGKDVIKAAVDCCFFPLYEIEHGITTITNMVADDKKQPVTEWLKMMGK
TKHLLKHQDLLDAFQKEVDRRWYRLKAMHESPLL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaatataatcttgctgaacaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttattacccaattacgcct
tctactcagattgctgagtacttagacgaaatgaaagctaacggaagacacacagtatgc
atgatacctggtgatggtgaacatggtgctgcaggtatatgttacggtgctgctactgca
ggaggaagagtatttaatgctacttctgctaacggtcttctttttgctatggagcaatta
cctgtacaatcaggtactagattccctatggtattaaatgttgtaaacagaacagtttct
ggtccgctagacattaaatgtgaccaatccgacataatgatggctcttaacactggttgg
attatcattatggctcatactactcaaatggtttatgacttcaatatctttgctttgaaa
atcgctgaaagagctaaattacctattatagtttcttctgacggtttctttacttctcac
caaaagaaaaaaattcacctattcaaaaatgataaagatgttcaggatttcttaggtaaa
tatactccagaagttacttctgttgaacctggaaaaaatcctgttacaatcggaccttac
atgaatgaagatgaattaacaggaagtaaattacagctttctcaagctttagaagatgct
cgtgctataattttagatgtatttgaagagtttgcttctttctctggaagaaaatactct
cctatagaaacttacaatatggaagatgctgaagtagctttaatgctttgcggttctgct
tatgaaactggtactttggctgttgatgaaatgagaaaagctaatcctaatcttaaaatt
ggtgcttttgctattactcaaattcgtcctttcccagaaaaagaattacaaaaattactt
gctaatgttaaagtagttgttgtaggagacagacaagattcatactctggtatgggcggt
aatatgtctaccgaaatcagagctgctcttaaaaatgatcctaataacaaatcttctatc
gttagcagagtttatggtcttggcggtactgagtttactttggaaaaagctaaagaatta
ttcgatttaggtttgaaagaattagctaatccaggttctgtagaaaaacattcttactta
gaacaatatatgggcgatcctaatgttaaaatgaaacctatacatgaacctcttactttg
gaaagccaaaaatccggcatcactgttactatgaatgaacaaactcataaacttgaagtt
aaaactcctcctcttagagaattaactggtaaagcttatcgttatgctcaaggtcatggt
gcttgtaacggctgcggtattttctctggtatcaatactttcatgaaaggtatagaaggc
gaagttgttcttttggtacatactggttgttctatggttgttactacaggttatccttac
agctcttacagaactacttatgttcacaacttgttccaaaatggtgctgctactctttct
ggtatagtagaaatgtatcatgaaagaaaaagaagaggtgaaatcgaaggaccagaagat
cctactttcataatggttactggagacggcggtcatgacataggtatgggaccttctatt
ggtgctgctataagaaatcacaaaatgattatattagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactccattgggacacagaacttctacttctaac
gttggtaaagctgaagttggtaaacaattcaaccacaaagatgtagctcaaatatttgct
ggatgtcatatcccttatgttgctaccggctgtgaagcttatccattagatttagttaaa
aaagctgctaaagctcaatggtatgctaaccatcatggtactgcttttgttaaacttctt
attgcttgtccattaaactggaaatctccagatgacatgggtaaagatgttatcaaagct
gctgttgactgctgtttcttcccattgtatgaaatagaacatggtatcactactatcact
aatatggtagctgatgataaaaaacagcctgttactgaatggcttaaaatgatgggtaaa
actaaacaccttcttaaacatcaagacttacttgatgcattccaaaaagaagttgataga
agatggtatcgcttaaaagctatgcatgaaagtcctcttctataa

DBGET integrated database retrieval system