KEGG   Brachyspira murdochii: Bmur_1769Help
Entry
Bmur_1769         CDS       T01229                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
brm  Brachyspira murdochii
Pathway
brm00010  Glycolysis / Gluconeogenesis
brm00020  Citrate cycle (TCA cycle)
brm00620  Pyruvate metabolism
brm00640  Propanoate metabolism
brm00650  Butanoate metabolism
brm00680  Methane metabolism
brm01100  Metabolic pathways
brm01120  Microbial metabolism in diverse environments
brm01130  Biosynthesis of antibiotics
brm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_1769
   00020 Citrate cycle (TCA cycle)
    Bmur_1769
   00620 Pyruvate metabolism
    Bmur_1769
   00640 Propanoate metabolism
    Bmur_1769
   00650 Butanoate metabolism
    Bmur_1769
  Energy metabolism
   00680 Methane metabolism
    Bmur_1769
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bmur_1769
Enzymes [BR:brm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bmur_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_10 Fer4_21 Fer4_17 Fer4_8 Fer4_4 Fer4_16 BRCT Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADG71851
UniProt: D5UAX8
Position
complement(2021308..2022342)
Genome map
AA seq 344 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLSQGFYGAAFSSYGSEKKGSPVKS
FVRFSEEEVRVNSTVEEPHVVAVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCVDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAEL
VEPNIEAFRKGGSESVVKDFPADGKYPYIPYKKPEPVYGKNNQLTGGYISAAGNSTLKDL
QVTRTGHIPVFNPKNCIDCANCEVVCPDLCIVWEKGPDRKDASKIAMNMMGIDYQYCKGC
LKCVRACPKGPYAAKQYPKEEQALRIEVEAECNVPELTYSRYKK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggctttttcgagatacgtctcgaaagtatcggt
ggaatgggtgctaatagtgcaggtaaaatgcttgcagaagtaggcgttttatcacaaggt
ttctatggtgctgcattctctagctatggttcagaaaaaaaaggttcacctgttaaatct
tttgtaagattctcagaagaagaagttagagtgaactctactgtagaagaaccacatgtt
gtggcagtattccacatgaatcttcttaaaaacccacttactttagctggtgttaaagaa
gatgctattgttatcttcaatactaataaaactcctgatgaagcaagagactttgctaaa
ttacatggcggtaaagtagtttgtgttgatgctataaaaatcgctaatgatttaaaactt
ccttctcaggcagctaatactatcataatgggtgctatggttaatcagcttgattttata
gattctgctaaatttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaatta
gtagaacctaatattgaagctttcagaaaaggcggaagcgaatctgtagttaaagatttc
cctgcagacggaaaatatccttatataccttataaaaaaccagaacctgtttatggtaaa
aacaaccaattgacaggcggttatataagtgccgctggcaactctactctaaaagattta
caagtaactcgtacaggtcatattccagtattcaatcctaaaaactgtattgactgtgct
aactgtgaagttgtttgtccagacctttgtatagtttgggaaaaaggaccagacagaaaa
gatgcaagcaaaatagctatgaatatgatgggtattgattatcaatattgtaaaggctgc
ttaaaatgcgtaagagcttgtcctaaaggaccttatgctgctaaacaatatcctaaagaa
gaacaagctttaagaattgaagtagaagcagaatgcaatgtaccagaacttacatacagt
cgttataaaaaataa

DBGET integrated database retrieval system