KEGG   Brachyspira murdochii: Bmur_1963Help
Entry
Bmur_1963         CDS       T01229                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
brm  Brachyspira murdochii
Pathway
brm00340  Histidine metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01230  Biosynthesis of amino acids
Module
brm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bmur_1963
Enzymes [BR:brm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Bmur_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Glyco_hydro_67N
Motif
Other DBs
NCBI-ProteinID: ADG72041
UniProt: D5UBG8
Position
complement(2239305..2240579)
Genome map
AA seq 424 aa AA seqDB search
MIKVINYKECKSLDDILLRSQFSYDDVNEKVKAILEDVKQNGDNALKKYAKMFDNAEIDN
LRVTEKEIEEAYNRVDEKFKETLKLAYNNIEKFHKKQLRNSFITNEEDGIVMGQIINPIE
KVGVYIPGGTAVYPSTVLMNVIPAKVAGVNEIILVSPPNKEGKINDNILAASKIAGVNKV
FKTGGAQAIAALSYGTESIPRVYKIVGPGNIYVAMAKRLVYGEVSIDMVAGPSEVLIIAD
ETSNPIHIASDMLAQAEHDKLASSILITTSKDIAEKVKEELYKQLEKLSRKDIAMESIEN
NGRIIITETIDESVYISNEIAPEHLEISIKEPFSVLSKIKNAGSIFLGDYTPEALGDYLS
GANHVIPTSGTAKFASPLSVDDFIKKSYITYYTKDALEKVKDNIINFAEHESLEAHANSV
KVRF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtaattaattataaagaatgtaagtcattagatgatatattattaagaagt
caattcagttatgatgatgttaatgaaaaggtaaaagcaatacttgaagatgttaaacaa
aatggagataatgcattaaaaaaatatgcaaagatgtttgataatgctgaaatagataat
ttaagagtaacagaaaaagagatagaagaagcatataatagagttgatgaaaagtttaaa
gaaacattaaaactagcttataacaatatagaaaaattccataaaaaacaattaagaaac
agttttataaccaatgaagaggacggtattgttatggggcagattataaaccctatagaa
aaagtaggagtttatatacccggaggcacagcagtttacccttcaacagtgcttatgaat
gtaatacctgcaaaagtagctggagtaaatgaaataatattagtatcgcctccaaacaaa
gagggcaaaattaatgataatatactagcagcatcaaaaatagctggagtaaataaagtt
ttcaaaacaggcggtgctcaggcgatagcagctttaagttacggcacagaatcaattcca
agagtatataaaatcgtaggaccaggaaatatatacgttgctatggctaaaagacttgta
tatggagaagtatctattgatatggtggcaggccctagcgaagtattaataatagcagat
gagacatccaatcccatacatatagcttctgatatgcttgcacaggctgaacatgacaaa
ttagcttcaagcatattaataacgacaagtaaagatatagcagaaaaagtaaaagaagaa
ttatataaacagttagaaaaattaagccgtaaggatatagcaatggaatctatagaaaat
aacggcagaataataataacagaaactatagatgagtctgtatatataagcaatgaaata
gccccagagcatttggagataagcataaaagagccattctctgtattaagcaagataaaa
aatgccggatctatatttttgggcgattatacccctgaagcattgggcgattatttatct
ggtgccaatcatgtaatacctacaagcggaacagctaaatttgcttctcctttatcagta
gatgactttataaaaaaatcttatataacatactacactaaagatgctttagaaaaagtg
aaggacaatataattaactttgcagagcatgaaagtttagaagcacatgccaattctgta
aaagtaaggttttaa

DBGET integrated database retrieval system