KEGG   Brachyspira murdochii: Bmur_2120Help
Entry
Bmur_2120         CDS       T01229                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
brm  Brachyspira murdochii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bmur_2120
Enzymes [BR:brm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bmur_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2410558..2411430
Genome map
AA seq 290 aa AA seqDB search
MSKSILVIGSINKDLVVNTPRFPKEGETILGNSFTTSNGGKGANQACAIGKLGGNVSMLG
AVGNDSFGKDLSNALSSNNVNIDNLIIKDNVATGIAIITVTQSGANNIVVAQGANALITK
DDIKEELISMYDIIVMQLEIPLDIAKYAACMAKKLGKTVVLNPSPAVKLDREFLSCIDIV
IPNETEIDIVGGVDYILECGVKNIILTLGAEGCDLITKEKRKHFDAYNVQVVDTTAAGDS
FLGGVIRMLADDKTMEEAIIFAVKVSNITVTRKGAIDSIPNYNEVINRKW
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaagtattttggtgataggaagtataaataaagatttggttgttaatacacct
cgtttccctaaagagggagaaactatacttggaaatagttttactacaagcaatggagga
aaaggtgccaatcaggcatgtgctataggaaaattgggcggtaatgtaagcatgcttgga
gcagtgggaaatgacagcttcggaaaggatttatcaaatgctttatcttcaaataatgtc
aatatagataatctgataattaaagataatgtagccactggaatagctataattacagtt
actcaaagcggtgctaataatatagttgtggcacagggagctaatgccttaataacaaaa
gatgatattaaagaagaacttatatctatgtatgatataatagttatgcagcttgagata
cctttagatatagcaaaatatgcagcatgtatggctaagaagctgggtaaaacagttgtt
ttaaatccatctcctgcagttaaacttgatagagagtttttaagctgtattgatatagta
ataccgaatgaaactgaaatagatattgtaggcggtgtagattatatacttgaatgcgga
gttaaaaatattatattaactttaggagctgaaggctgcgatttaataactaaagaaaaa
agaaaacattttgatgcatataatgttcaggttgttgataccactgcggcaggagatagt
tttttgggaggagttataagaatgcttgctgatgataaaactatggaagaggctatcatt
tttgctgtgaaggtatcgaatattactgttactaggaaaggagctatagattctatacca
aattataatgaagttattaatagaaaatggtga

DBGET integrated database retrieval system