KEGG   Brachyspira murdochii: Bmur_2127Help
Entry
Bmur_2127         CDS       T01229                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
brm  Brachyspira murdochii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bmur_2127
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmur_2127
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmur_2127
Enzymes [BR:brm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bmur_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2418112..2418885)
Genome map
AA seq 257 aa AA seqDB search
MSNIYKAFENKKAFIPFITCGYPSLELTEDIIYSMIENGADLIELGIPFSDPTAEGLVIQ
NANEKALKNHVTREKIFDMVRRIRKNSDIPLVFMTYANVVYSYDIENFLSISKEINIDGL
ILPDVPFEEKNIFEPFCKKYDIDLISLIAPTSENRIHKISKEASGFVYCVSSLGVTGVRQ
KIETDIAKIVDLIKKNTNIPAAVGFGISTTEQAKNISKYSDGVIVGSAIIKLCDKYENNS
PKYIGEYVRDMKNAMNE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatatacaaagcatttgaaaataaaaaagcatttataccttttataacctgc
ggatatccttctttagaattaacagaggatattatatattctatgattgaaaatggggct
gatttgatagagcttggaatacctttttcggatcctactgcagagggtcttgttatacaa
aatgccaatgaaaaagctttaaaaaatcatgtaaccagagagaaaatttttgatatggtt
agaagaataagaaaaaacagcgatatacctttagtttttatgacttatgctaatgttgtt
tattcttatgatatagaaaattttttatccatatcaaaagaaataaatattgacggatta
atacttccagacgtaccattcgaagagaaaaatatatttgagccattttgcaaaaaatat
gatattgatttaatttctttaatagctcctacttcagaaaacagaatacataaaatttca
aaagaggcatcaggttttgtgtactgcgtatcatcgcttggagttacaggagttcgtcaa
aaaatagaaacagatattgctaaaattgtagacttaataaagaaaaatacaaatatacct
gcggcagttggatttggtatatcaacaacagaacaggctaaaaatataagtaagtattct
gatggtgtcatagttggaagtgcaataataaaactttgcgataaatatgaaaataattcg
ccaaaatatataggagagtatgtgagagatatgaaaaatgctatgaatgaataa

DBGET integrated database retrieval system