KEGG   Brachyspira murdochii: Bmur_2477Help
Entry
Bmur_2477         CDS       T01229                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
brm  Brachyspira murdochii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:brm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bmur_2477
Enzymes [BR:brm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bmur_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2795389..2795973
Genome map
AA seq 194 aa AA seqDB search
MFAFIEGNVQIISEGVIALVCNGVGYEIIVSKKLEVKNDDKIRLYTQLIHKEDAMILYGF
LTREEKKMFSTLIAASGVGPKLAMEILSTYSINDLMHILFNKDINLLKKVQGMGLKKAEK
LLFELRDKIEKIDINISSSSVQNYNDNESDVIKALISLGFSNNEAVKALSSIENKDNMSA
EDLISNALRNLSSI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttttatagaaggtaatgttcagataatatccgagggtgtcatagctcttgtt
tgtaatggtgttgggtatgagattatagtatcaaaaaaacttgaagtaaaaaatgatgat
aaaataagactttatactcagcttatacataaagaagatgctatgatactttatggtttt
ttaactagagaagaaaaaaagatgttttctacacttatagcagcttcaggtgtgggacct
aaacttgctatggagatactttctacatattcaattaatgatcttatgcatatacttttt
aataaggatattaatttattaaaaaaagttcagggtatgggattgaaaaaggctgagaaa
cttttatttgaacttagagataaaatagaaaagattgatattaatatttcttcttcatct
gttcaaaactataatgataatgaaagcgatgttataaaggctttaatatcattaggtttt
tcaaataatgaggctgttaaggctttgtcttcaatagaaaataaagataatatgtcggca
gaagatttgataagtaatgctttaagaaatttaagttctatataa

DBGET integrated database retrieval system