KEGG   Brachyspira murdochii: Bmur_2537Help
Entry
Bmur_2537         CDS       T01229                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
brm  Brachyspira murdochii
Pathway
brm00230  Purine metabolism
brm01100  Metabolic pathways
Module
brm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bmur_2537
Enzymes [BR:brm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bmur_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 ATPase_2 AAA_33 MMR_HSR1 AAA_23 Tfb5 EFP AAA_14 TniB MobB cobW AAA_16
Motif
Other DBs
NCBI-ProteinID: ADG72606
UniProt: D5U6A7
Position
complement(2866997..2867548)
Genome map
AA seq 183 aa AA seqDB search
MSNIVVITAPSAAGKTTLIKKYLSNHPNATFSVSYTTRPQRPNEVEGKDYYFIDKEKFEQ
MINEGDFIEWASVHDNYYGTSFKELEKADDENVILILDIDIQGALYIKEKGIDANYIFIT
PPSMEELKKRLEERGTETEESIKLRIWNAKRELEYKDKFDIIIENNDIEEAYTKLEEAIN
SKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgttgttattacagccccatcagctgcaggtaaaactactttaataaaa
aaatatctatctaatcaccctaacgcgactttcagcgtttcctataccaccagacctcag
cgtcctaatgaagttgaaggcaaagactattacttcatagataaagaaaagtttgaacaa
atgattaatgaaggcgattttatagaatgggcttctgtacatgataattattacggaaca
tctttcaaagaattagaaaaagccgatgatgaaaatgtcatactaatactcgatatagat
attcaaggtgctttatatataaaagaaaaaggtatagacgcaaattatatattcataaca
cctccttctatggaagagttaaagaaaagacttgaagaaagaggtactgaaacagaagaa
agcatcaaacttagaatatggaacgccaaaagagaattagaatataaagataaatttgat
atcattatcgaaaataatgatattgaagaagcttatacaaaattagaagaggctatcaat
tctaaattataa

DBGET integrated database retrieval system