KEGG   Brachyspira murdochii: Bmur_2567Help
Entry
Bmur_2567         CDS       T01229                                 

Definition
glycoside hydrolase 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
brm  Brachyspira murdochii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bmur_2567
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bmur_2567
Enzymes [BR:brm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bmur_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2902308..2903411
Genome map
AA seq 367 aa AA seqDB search
MLKALKTNKKIISCILYLFIILLFSYACKTASNVLKEKEYILKLKKDYPELSYYIDEVSK
MSKKERRGLLLMVGIKDKVLSKETIKTLKDNNIIGVILFDYNIKDEKQLKELTSDLRKYV
NSNMLISIDQEGGEVNRIDFDPLKDISPKNIGDSNSTEYAYDIAYKKSKFLLDLGINVIL
GSLCDIPSDSNSYLYNRSFSANTDVAARMAEYTVKAQRDAGIISVLKHFPGHGDTAVNSH
NDFPVIDKTTNELFLKEFVPFKRAIDAGAEMVLAAHIKNKYIDNEKPASMSREYAYILEN
ELGFNGVVITDDLAMTGDIDKGINFGINLISNLYENVEYMFEDIDADILSCARVLKMASE
NVLSSRT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagctctcaaaactaataaaaaaattataagctgtatattatatttatttata
atattattattttcgtatgcatgtaaaactgcttcaaatgtacttaaagaaaaagaatat
atattaaaattaaaaaaggattatcctgaattatcatattatatagatgaagtatccaaa
atgagtaagaaagaaagaagaggacttttacttatggtaggaataaaagataaggtactc
tctaaagaaactattaaaacacttaaagataataatataattggggtaatactttttgat
tataacataaaagatgaaaaacagcttaaagagttgacaagcgatttaagaaaatatgtt
aactcaaatatgttaatttctatagaccaagaaggaggcgaagtaaaccgcatagacttt
gaccctcttaaagatatatctcctaaaaatataggggattcaaacagtactgaatatgca
tatgatatagcatacaaaaaatcaaagttcttacttgatttaggcattaatgtaatatta
ggatcattatgtgatatacctagtgatagtaattcttatttatataatagaagtttttct
gctaatacagatgtagctgcaagaatggcagagtatacagtaaaggcacagagagatgca
ggaattataagcgtattaaaacattttccgggacatggcgatacagcagtaaactctcat
aatgattttcctgttattgataaaaccacaaatgagctttttttgaaagagtttgttcct
tttaaaagagcaatagatgcgggagctgaaatggttttggcagcacatataaaaaacaaa
tatatagataatgaaaaacctgccagtatgtcaagagagtatgcttatatactagaaaat
gaattaggttttaatggagttgttattacagatgatttagctatgactggcgatattgat
aagggaattaattttggtataaacttaattagtaatttatatgagaatgtagaatatatg
tttgaagatatagatgcggatattctttcatgtgcgagagttctaaagatggcttcagaa
aatgtcctttcttcccgcacataa

DBGET integrated database retrieval system