KEGG   Brachyspira murdochii: Bmur_2683Help
Entry
Bmur_2683         CDS       T01229                                 

Definition
(GenBank) bifunctional pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
brm  Brachyspira murdochii
Pathway
brm00760  Nicotinate and nicotinamide metabolism
brm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bmur_2683
Enzymes [BR:brm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Bmur_2683
    3.5.1.-  
     Bmur_2683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADG72750
UniProt: D5U726
Position
3041358..3041999
Genome map
AA seq 213 aa AA seqDB search
MSKIKILTIVDMQNDYMEGGPMAVKGAVKLVPVINDLIKNGEYDAIIATQDWHPSNHISF
ASTHEKEPFSKIKVIDQDTGDEEILTLWPRHCVARTYGSAIVDGLRKKRDYIYVQKGVDP
DDEGNSGFSYMHKEFIDAARENKETLILDFVGVALDYCVFYTARDTAEYVASIDAEYLVS
VNVLEYASAAVNPDVIEGLYSSCPLINLKKVRL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaagatattaacaatagtagacatgcaaaatgattatatggaaggcggt
cctatggcagtaaaaggtgctgtaaaacttgtacctgtaatcaatgatcttataaaaaat
ggggaatatgatgctataattgccacacaggattggcatccttccaatcatatatcattt
gcttctactcatgaaaaagagcctttttcaaaaataaaagtaatagatcaggatacagga
gatgaagagatattaactctttggcctcgtcattgtgttgcaagaacttacggttcggct
atagttgacggtcttagaaagaagagagactacatatatgttcaaaagggggttgaccct
gatgatgagggtaactctggattttcttatatgcataaagagtttatcgatgcggcaaga
gaaaataaagaaacgctgatacttgattttgtaggtgttgctttggattactgcgtattt
tatacagcaagagatactgcagaatatgtagcttctattgatgccgagtatttagtcagc
gttaatgtacttgaatatgcatcggctgctgttaatcctgacgtgatagaagggctttat
tcatcatgccctcttattaatcttaaaaaggttagactgtga

DBGET integrated database retrieval system