KEGG   Brachyspira murdochii: Bmur_2714Help
Entry
Bmur_2714         CDS       T01229                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
brm  Brachyspira murdochii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmur_2714
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_2714
   00052 Galactose metabolism
    Bmur_2714
   00500 Starch and sucrose metabolism
    Bmur_2714
   00520 Amino sugar and nucleotide sugar metabolism
    Bmur_2714
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bmur_2714
   00524 Butirosin and neomycin biosynthesis
    Bmur_2714
Enzymes [BR:brm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bmur_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3082657..3083613
Genome map
AA seq 318 aa AA seqDB search
MKDVVIAIDIGGTSMKGAIIEENGNILYKDNFDVDPKHTTEEHKKVISEFVEKLKSNIPN
NYKAVGLGIDCPGVMNRETLHMGGAENIPGLKGLKFSDIGDRFNLPTKTANDASMAALGE
AKYGSGKEKAYQSVMFVTLGTGVGGGFVLNGQLFTGSLGGAGEIGHVFVVPDGDKCNCGS
SGCIERYASATGFIAMAKQKIHKGVIPTSLTYEELDKGKAKALFDAAKKGDELAKETIAE
CSYYLGMSIAQALNMLDLDLVLIGGGLCKDFDMMIEHIKRGVRNYGLRMMVNNVEIKPAS
LGNDAGVLGCAALFFRNN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttgttatagctatagatataggcggcacttctatgaaaggtgctattata
gaagaaaacggaaatattttatataaagataattttgatgttgaccctaaacatactaca
gaagagcataaaaaagttatttctgagtttgtagaaaaattaaaaagtaatattcctaat
aattataaagcggtaggattgggtatagattgtcccggagtgatgaacagagaaactctt
catatgggaggagcggaaaatatacccggacttaaaggattaaagttttcagacatagga
gatagatttaacctacctacaaaaacagctaatgacgctagtatggctgctttaggagag
gctaaatatggaagcggtaaagaaaaggcttatcagtccgtgatgtttgttacacttgga
acaggtgtcggaggcggatttgtacttaatggacagttattcacaggttctttaggcgga
gctggagagattggtcatgtatttgtagttccagatggtgataaatgcaactgcggttca
agcggctgtatagagcgttatgcttctgctactggttttattgctatggctaagcaaaag
attcataaaggcgttattcctacttcacttacttatgaagagttagataaaggtaaggct
aaggctttatttgatgctgccaaaaaaggcgatgaacttgctaaagaaactattgcagaa
tgttcttattatttgggtatgtctatagcacaggctttgaatatgcttgatttggatttg
gtacttataggcggagggctttgtaaggattttgatatgatgatagagcatattaaaaga
ggtgtaagaaattatggacttagaatgatggttaataatgttgaaataaaacctgcttct
ttgggtaatgatgcgggtgttttgggatgtgccgctttatttttcagaaataattaa

DBGET integrated database retrieval system