KEGG   Brachyspira murdochii: Bmur_2802Help
Entry
Bmur_2802         CDS       T01229                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
brm  Brachyspira murdochii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:brm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:brm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3188938..3190464)
Genome map
AA seq 508 aa AA seqDB search
MKLFKEIIKGYKVSKEKQLTKECLNIEIRGIAYNSKLIKNKYIFVAIKGLKDDGHKYIES
AINNKAAIIIYDNSADKNFIKELEDKHTYVYFIAVKNPRECLAYISAKFFDEPTKKINTI
AITGTNGKTTTTYLLKSVLEANKNKTALIGTIKNMIGKTEIKTNLTTPESIDLENIFDKA
LKKEVSHIVMEASSQALAMDRCDYLNYDTAIFTNITEDHLDYHGDMQNYLKAKLKLFSLL
KESSKNKKLAIVNIDTDNFKQISNYIKKLGIKMVTYGLNEKADYYGKIISLNSKNTEYEF
YSKGKFISKVKLSMLGRFNILNSLSVLAYVSEYKLDIEKSIKAMRKVQVAGRFEIVTKEK
HPFIAAVDYSHTPDSLENILKEARKLNPKRVIVVFGCGGDRDRKKRPIMASIAEKYSDIS
ILTADNQRTEDINQIMNDIEKGFKNKDYKKIIDRKEAIFEAIKEAKENDIVIIAGKGHET
YQIFPDKTIHFDDREIAREALKKRYKNI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttttaaagaaattatcaaaggatataaagtatcaaaagaaaagcaattaact
aaagaatgtttaaatatagaaataagaggcatagcatataattctaaattaataaaaaat
aaatatatttttgtagctataaagggattaaaagatgacggacataaatatatagaaagt
gccattaacaataaagcggctatcataatatatgataattcagctgataaaaactttata
aaagaattagaagataaacacacatatgtatattttatagcagtaaaaaatccaagagaa
tgtttagcttatatttcggcaaagttttttgatgagcctactaaaaagattaacactata
gcaatcactggtactaacggaaaaacaactacaacatatttattgaaatcagtacttgaa
gcaaataaaaataaaactgctttaataggtacaattaaaaatatgataggaaaaacagaa
ataaaaactaacctcacaactccagaatctattgacttagagaatatatttgataaggca
ttaaaaaaagaagtgtctcatatagttatggaagcatcatctcaggcacttgcgatggac
agatgcgattatttaaattatgatacagctatttttaccaatatcacagaagaccatctt
gattatcatggagatatgcaaaattatcttaaagcaaaattaaaattattctcacttcta
aaagaaagctctaaaaataaaaaattagcaatagttaatatagatactgataactttaag
caaatatcaaattacataaaaaaacttggcataaaaatggttacttacggacttaatgaa
aaagctgattattacggaaaaataatttctcttaattcaaaaaacacagaatatgagttt
tattctaagggtaagtttatatcaaaagtaaaattatcaatgcttggaagatttaatatt
ttaaactctttatcagtattagcttatgtttctgaatataaactagacatagaaaaatca
attaaagctatgagaaaggttcaggtggctggaagatttgaaatagtaacaaaagaaaaa
cacccatttattgctgctgttgattattcccatactccagacagcttagaaaatatatta
aaagaggctagaaaattaaatcccaaacgagtaatagtcgtatttggatgcggcggagac
agagacagaaaaaaacgtcctataatggcaagcattgcagaaaaatattcggatatatct
atactcactgctgacaatcaaagaacagaagatattaatcaaataatgaatgatattgaa
aaaggatttaaaaataaagattataaaaaaattatagacagaaaagaagcaatatttgaa
gctataaaagaagcaaaagaaaatgatatagttataatagcaggcaaaggtcatgaaact
tatcagatatttccagataaaacaatacattttgatgacagagaaatagcaagagaggct
ttaaaaaaacgttataaaaatatttaa

DBGET integrated database retrieval system