KEGG   Brassica rapa (field mustard): 103838379Help
Entry
103838379         CDS       T03449                                 

Definition
(RefSeq) acid beta-fructofuranosidase 3, vacuolar
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
brp  Brassica rapa (field mustard)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103838379
   00500 Starch and sucrose metabolism
    103838379
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103838379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
A9
AA seq 654 aa AA seqDB search
MASSESLLPVSSQQDPLSDSRCDSIPESRRRRPIKVHLAIYSGFLLIALYVTLIITHGGS
APKNDVNDDTTVESRARLAGVSEKSNDHIWNLSNDLKGEAFAWNNTVLSWQRTAFHFQPE
KNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFAMVPDQWYD
ANGVWTGSATFLDDGSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPP
PGIGAKDFRDPTTAWKTSDGKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNT
GMWECVDFYPVSKTKDKGLDTSVNGLDVKHIIKASMDDTRIDHYAIGTYYDSNATWVPDN
PSIDVGISTGLRYDYGKFYASKTFYDQHKGRRILWGWIGESDSEAADVQKGWSSVQGIPR
TVALDTKTGKNLVQWPVKEIESLRLGRKKFHMKVEPGTVVPVDVGPAAQLDIEAEFKIKK
DDLEVVFGDDSVEDDKEFSCETSGGATVRGALGPFGFSVLADQSLSEQTQVYFYVTKGKD
SKLKTFFCTDTSRSTMANDVVKPVYGSFVPVLKGEKLTMRILVDHSIIEGFGQGGRTCIT
SRVYPTKAIYGATRLFLFNNAIDATITASFKVWQMNSAFIHPFSANDLGVPSST
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctctgaatctctcttgccggtcagctctcaacaagatccattatctgattca
agatgcgactctatcccggagagccggagaagaagacctattaaagttcatctcgccatc
tattctggttttcttttgattgctttatacgttactctcatcattacacacggcggatcc
gcacccaaaaatgatgtcaatgatgacacgacggtggagtcacgtgctcgtttggccggc
gtgtcggaaaagagcaacgaccatatttggaatctttccaatgatctgaaaggagaagcg
tttgcctggaacaatactgtattgtcgtggcaacgaactgcgtttcatttccaacctgag
aaaaattggatgaacgatcctaatggtccattgttttacaagggatggtaccatttcttc
tatcaatacaacccaaatgcagccgtgtggggtgacattgtttggggtcacgctgtatca
aaggatcttatccactggctttacctcccatttgccatggttcctgaccaatggtacgat
gctaacggcgtttggaccggttcagctacttttcttgatgatggttctattgtcatgctc
tacactggttccaccgacaaattcgtacaggttcaaaaccttgcctatcctgaagaccca
aaagatccacttttgttgaaatggaccaagttctccggcaacccggttcttgtaccacct
ccaggtatcggtgctaaggacttccgtgacccaacaactgcatggaagacatcagatggg
aagtggcggatcactattggctccaaaatcaacagaaccggtatatctcttatttacgac
acaacagatttcaagacctacgagaaacatgagaccttgttgcaccaagtcccaaacact
ggaatgtgggagtgtgttgacttttatccagtgtccaagactaaagacaagggtcttgat
acttcggtcaatggactggatgttaagcatatcattaaggctagcatggacgatactaga
attgaccattatgccattgggacatactatgattctaacgcaacatgggtccccgataat
ccttcaatcgatgtcgggattagtactggtttgagatatgattacggtaaattttatgca
tccaagacgttttatgatcaacacaagggacgaagaatcttatggggttggattggtgaa
tctgatagcgaagcagctgatgtacagaagggttggtcttctgttcagggcatccctaga
actgtcgcattggacacaaagacagggaagaacttagtccagtggccagttaaggaaatt
gagtctctgagattaggacgcaagaagttccacatgaaggttgaaccagggacggtagtt
ccagttgatgtaggccccgccgcacagctagacatagaggctgagttcaagatcaagaag
gacgatctcgaagtagtctttggagatgactccgtggaggacgacaaggagttcagctgt
gaaacaagcggtggagccaccgtacgtggggctttaggacctttcggattctcggttctt
gctgaccaaagcttgtcggaacaaactcaggtttacttctatgtgactaagggaaaagat
tcgaaactcaaaacgttcttctgcactgacacctcaaggtcgaccatggcaaatgatgtt
gtgaaaccggtatatggaagcttcgtaccggttctaaaaggagagaaattgaccatgaga
atcttggtggatcattcgataatagaggggtttggacaaggtggaagaacatgtattacc
tcaagggtttatccaacaaaggccatctacggagctacaaggcttttcttgttcaacaat
gctattgatgcgactattacggcgtcgtttaaggtgtggcaaatgaacagtgcttttatt
catcctttctctgcgaacgatttgggtgttccttctagcacctga

DBGET integrated database retrieval system