KEGG   Brassica rapa (field mustard): 103842088Help
Entry
103842088         CDS       T03449                                 

Definition
(RefSeq) caffeoylshikimate esterase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
brp  Brassica rapa (field mustard)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103842088
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103842088
Peptidases [BR:brp01002]
 Serine Peptidases
  Family S33
   103842088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
A9
AA seq 337 aa AA seqDB search
MTKLKFDYEEEYIRNSRGVELFACRWVPSSSPRALIFLCHGYGMECSGFMSECGIRLASA
GYAVFGMDYEGHGRSKGARCYIKKFGDIVNDCYDYYTSISAQEKYRGKGRFLYGESMGGA
VALLLHKKDPSFWNGALLVAPMCKISEKVKPHPVVINLLTRVEEIIPKWKIVPTKDVIDA
AFKDPVKREEIRNNKLIYQDKPRLKTALEMLRTSMNLEDTLHEITLPFFVLHGEADTVTD
PEISKALFEKASTRDKTIKRYPGMWHGLTSGETDANVDLVFADIINWLDVRTGDATSLTA
NVEKVACNDQGEPKGEQASLLGGLNGGGRRVVHRSSM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagttaaagtttgattacgaggaggaatacataagaaactcgagaggcgtcgag
ttgtttgcctgcagatgggttccatcttcttctcccagagctctcatcttcctctgccat
ggctacggaatggaatgcagcggcttcatgagtgaatgcgggatacgactggcttcagca
ggatatgcggtatttggaatggactacgaaggtcatggtcggtccaaaggagctcgttgt
tatattaagaagtttggtgacatagtaaacgactgctacgactattacacctcaatctct
gcgcaagaaaagtacagaggaaagggtagattcttgtatggagaatcaatgggaggtgcg
gttgctttgttgcttcacaagaaagatccttctttctggaatggtgcccttctcgtcgct
ccaatgtgtaagatatcagagaaggtgaaaccacatccagtagtgattaatctactaacg
agagttgaagagattataccaaagtggaagatcgtgcccaccaaagatgttatcgatgct
gccttcaaagatccggtcaagcgcgaagagataaggaacaacaagctgatatatcaagac
aaaccaagactcaaaacggcacttgagatgcttagaacgagcatgaacctcgaagacact
ctccacgagatcacgttacctttctttgttctccacggtgaagcagacacagtgaccgat
ccagagattagcaaagctctgttcgagaaagcaagtacacgtgacaaaaccattaaacgt
tacccaggcatgtggcatgggttgacttctggtgagactgacgccaacgttgacctcgtt
tttgctgacatcattaattggcttgatgttcgtaccggcgacgccacttcactcactgca
aatgttgaaaaggtcgcttgtaacgatcaaggggaacctaaaggagaacaggctagtctc
cttggtgggttaaatggtggtggacgccgtgtggtccatcgatcttctatgtaa

DBGET integrated database retrieval system