KEGG   Brassica rapa (field mustard): 103852873Help
Entry
103852873         CDS       T03449                                 

Definition
(RefSeq) protein STRICTOSIDINE SYNTHASE-LIKE 11-like
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
brp  Brassica rapa (field mustard)
Pathway
Indole alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103852873
Enzymes [BR:brp01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     103852873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
A2
AA seq 325 aa AA seqDB search
MTSFVSVISLLLSFSLAIFSDAASFQKFPVPGKRSGPEAFAFDSTGKGFYTGVSGGKIFK
YLPGKGYVDFGYITVSSKSQWCDGALGIAYMSKCGRPAGIAFNNKTGELYVADAPLGLHV
IPSGGGYAKKIADSADGKPFLFLDGLDVDPTTGVVYFTSFSSKFSPGDVLKAVASKDASG
KLFKYDPSKRVVTVLLEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGSKAGTSEDF
TNAVSNPDNIKRIGSSGNFWVASVVNTATGPTNPSAVKINSDGRVLQTISVKDKFGDTLV
SEVNEFEGRLYVGTLSGPFAGIIDL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgtttgtttccgtgatttctcttcttctctcattttctctggccattttctca
gatgctgcgtccttccaaaaatttccggtgccgggaaaaaggtcaggccctgaagctttc
gcctttgattccaccggaaaaggtttctacaccggagtttccggcggtaaaatctttaaa
tatctaccggggaagggttacgtcgattttggctatatcacagtatcctcgaagtcgcaa
tggtgcgatggagcacttggaatagcttatatgagtaaatgcggccggccggccggaata
gcattcaacaacaaaacaggagagctctacgtggccgatgctccgttgggtctccacgtc
attcctagtggtggtggctacgccaagaagatcgccgacagtgctgacggcaagcccttc
ttgtttctcgatggcctcgacgttgatcccacaaccggggtcgtctacttcacttccttc
agctcaaaatttagccctggcgacgtgttaaaagcagtggcatcaaaagacgcttccggg
aaactcttcaagtacgatccatcaaaaagggtcgtgactgtcttgctcgaaggtctaagt
ggctcagccggttgtgccgttagctcagacggttcgtttgtgctggttagtcagttcacc
aagagtaacatcaagaggtattggatcaaggggtctaaagctggtacttctgaagacttc
actaatgcggtctcgaaccctgacaatatcaagaggatcggttcttccggaaacttttgg
gttgcttcggtcgtgaacacagccaccggaccaacaaacccgtctgcggttaaaattaac
tctgatggtagagtgcttcagacaatttcggtgaaggataagtttggagatactttagtc
agcgaggttaacgaattcgaaggaaggctttatgtcggaactctgtctggtccttttgcc
ggaattattgacctttaa

DBGET integrated database retrieval system