KEGG   Bradyrhizobium sp. S23321: S23_00870Help
Entry
S23_00870         CDS       T01796                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_00870 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S23_00870 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S23_00870 (trpA)
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     S23_00870 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(103804..104640)
Genome map
AA seq 278 aa AA seqDB search
MTTRIDTRFAELKKQGRSAFVTFLMAGDPDPATSLEIIKALPKAGADVIEIGMPFTDPMA
DGPSIQAAGLRALKAGMTLKKTLELVRGFRKDDNATPIVLMGYYNPIYIYGVDKFLVDAK
SAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADSSAVSEAVARIKRHTKLPVCVGFGIRTPETARSIASHANGAVVGTALVDA
LKNSLDADGRATAKTVNAVAELTASLAQGVRGAQQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgcgtatcgacacccgtttcgcagaattgaagaagcagggccgctcggccttc
gtcaccttcctgatggccggcgatcccgatccggcgacgtcgctcgagatcatcaaggca
ttgccgaaagctggcgccgatgtgatcgagatcggcatgccctttaccgatccgatggct
gacggtccgtcgatccaggccgcgggcctgcgcgcgctcaaggccggcatgacattgaag
aagacgctcgaactcgtgcgcggcttccgcaaggacgacaacgcgacgccgatcgtgctg
atgggctattacaatccgatctacatctacggcgtcgacaaattcctggtcgatgcgaag
agcgccggcgtcgatggcctcatcatcgtcgacctgccgccggaagaggacgaggagctc
tgcctgcccgcgatgaaggccggcctcaacttcatccgcctggcgacgccgacgaccgac
gacaagcgtctgccggccgtgctcgccaacacctcgggcttcgtctattacgtctcgatc
accggcatcaccggggccgcggccgcggactcctcggccgtcagcgaggcggttgcccgc
atcaagcggcatacgaaactgccggtctgcgtcggcttcggcatccggacgccggagacc
gcgcgctcgatcgcctcgcatgcgaatggcgccgtggtcggcaccgcgctggtcgacgcg
ctcaagaacagcctcgatgcggacggccgcgcgaccgccaaaaccgtcaacgccgtcgcc
gagctgacggcgtccctggcccagggcgtcaggggtgcgcaacaggcggcggaatag

DBGET integrated database retrieval system