KEGG   Bradyrhizobium sp. S23321: S23_00880Help
Entry
S23_00880         CDS       T01796                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_00880 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S23_00880 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S23_00880 (trpB)
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     S23_00880 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(104637..105854)
Genome map
AA seq 405 aa AA seqDB search
MNIAKPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYTEAKADPAFQAEMDGYLK
NYVGRPSPLYFAERLTEHLGGAKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAE
TGAGQHGVATATLCARFGLECIVYMGAVDVERQQPNVIRMEMLGATVMPVQSGTRTLKDA
MNEALRDWVTNVHNTFYCIGTVAGPHPYPTLVRDFQSIIGNETKAQMQEIEGRLPDSLVA
CIGGGSNAMGLFHPFLDDSTVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDA
DGQIQDAHSISAGLDYPGIGPEHSWLHEIGRVNYLSATDDEALAAFQLLSKLEGIIPALE
PAHAIAKVMELAPKRPKDHLMVVNLSGRGDKDVPQVGDILKGKSK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgccaaaccaaactcctaccgaagcggccccgacgagcgcggccatttcggc
attttcggcggacgcttcgtcgccgaaaccctgatgccgctgatcctcgatctggaaaag
gcctacaccgaggccaaggccgatccggccttccaggccgagatggacggctatctcaag
aactatgtcggacggccctcgccgctgtatttcgccgaacgcctgaccgagcatctgggc
ggcgccaagatctatctgaagcgcgaagagctcaatcataccggctcgcacaaggtgaac
aacgtgctcggccagatcatgctggcgcggcgcatgggcaagaagcgcatcattgccgag
accggcgccggccagcacggcgtcgccaccgcgacgctgtgcgcgcggttcgggctcgaa
tgcatcgtctacatgggcgcggtcgacgtcgagcgacagcagcccaacgtgatccgcatg
gagatgctgggcgccacggtgatgccggtgcagtcgggcacgcgcacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtgcacaacaccttctattgcatcggc
acagtggcgggtccgcacccctatccgacgctggtgcgcgatttccagtcgatcatcggc
aacgagaccaaggcgcagatgcaggagatcgaaggccgcctgccggattccttggttgcc
tgcatcggcggcggctcgaacgcgatgggcctgttccatcccttccttgacgattccacc
gtcgagatcttcggcgtcgaagccgccggccacgggctcacgcagctgcatgccgcctcg
atcgccggcggccgtcccggcgtgctgcacggcaaccgcacctatctcctgatggacgcg
gacggccagatccaggacgcgcattcgatctcggccggcctcgactatcccggcatcggc
cccgagcattcctggctgcacgagatcggccgcgtgaactatctctccgcgaccgacgac
gaggcgctcgccgcgttccagctgctgtcgaagcttgaaggcatcatccccgcgctcgag
cccgcgcatgccatcgccaaggtgatggagctcgcaccgaagcggccgaaggaccacctg
atggtcgtcaatctctccggccgcggcgacaaggacgtaccgcaggtcggcgacatcctg
aagggcaagagcaagtga

DBGET integrated database retrieval system