KEGG   Bradyrhizobium sp. S23321: S23_02120Help
Entry
S23_02120         CDS       T01796                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
brs  Bradyrhizobium sp. S23321
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221520..222593
Genome map
AA seq 357 aa AA seqDB search
MAANSTRQAMDSGFDDPDHDYAASIAGRAMRSMAEQRIPPTPANFAVWFRYFAGSQDDLR
NAVDLLIDHNRPFDAGTNRNLFETYVAPQVSAVALNTSERLHTLMGAAKGFLATAIADNQ
SQIQAISEVTDQGNAGVDPKVLVGQLMNELARAATRATRLEAGFAEKTRELDVIRDSLSK
SEERARTDMLTGLANRRALDEFLRQAQTTADWGEPLSVLLLDIDHFKSFNDNFGHSVGDQ
VLRLMARVLREKVRQQDLPARYGGEELIAVLPDADLAICAEIAEVIRRAIAECTITRRST
GEMLPSISVSIGVAQYRTGEAITDLIERCDRALYLAKGGGRNRVVTESELDRAAAAG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttggccgccaacagcacccgccaggcaatggattcaggcttcgacgatcccgatcacgac
tatgccgcgtccatcgccggacgggcgatgcggagcatggccgagcagcggattccgccg
acgccggccaattttgccgtctggttccggtattttgcaggcagccaggacgatttgcgc
aacgccgtcgatctcctgatcgaccacaatcgcccattcgacgccgggaccaatcggaat
ctgtttgagacctatgtcgcgccccaggtaagcgccgtcgccctcaacacgtccgagcgg
ctgcataccctgatgggcgcggcgaaggggtttctggcgaccgcgatcgcggacaaccaa
tcccagatccaggcgatcagcgaggtgaccgaccagggcaacgccggcgtcgatccgaag
gtgctggtcggtcagctcatgaacgagctggcgcgcgccgcgacgagagcgacacggctc
gaggcaggctttgcggaaaagacccgcgagctcgacgtgatccgcgattcgctctccaaa
tccgaggagcgcgcccggacggatatgctgacgggcctcgcaaaccggcgagcgctcgac
gagtttctgcgccaagcgcagacgacggcggactggggcgagccgctcagcgtgctcttg
ctcgacatcgaccacttcaagagtttcaacgacaatttcggtcacagcgtcggcgaccag
gtgctgcggctgatggcgagggtgctgcgcgaaaaggttcgtcagcaggatctgccggcg
cgctatgggggcgaggaactgatcgcggtgctgccggatgccgatctcgccatttgcgcc
gagatcgccgaggtcatcaggcgcgcgatcgccgaatgcacgatcacgcggcgctcgacc
ggcgagatgctgcccagcatcagcgtgtcgatcggcgtggcgcagtaccggaccggcgaa
gcgatcaccgatctgatcgagcgctgcgaccgcgcgctctatctcgccaagggtggcggc
cgcaatcgcgtggtgacggagagcgagctcgatcgcgccgcagctgcgggttag

DBGET integrated database retrieval system