KEGG   Bradyrhizobium sp. S23321: S23_02590Help
Entry
S23_02590         CDS       T01796                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:brs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:brs00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:brs00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:brs00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:brs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(267959..269905)
Genome map
AA seq 648 aa AA seqDB search
MSEKIYDVPAEWAKRAWVDQAKYKDMYARSISDPNAFWAEQAKRIDWMHAPTKIENVSFA
PGNISIKWFEDGILNVAHNCIDRHLHNRANQTAIIWEGDDPSQSKHITYQELHDEVCRMA
NILRTRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDSLAQRINDCQSK
VVITADEGLRGGKKVPLKANVDAALAKADGVDWVVVVKRTGGKVDMNPTRDLWYHEAAAM
VTTECPAEHMHAEDPLFILYTSGSTGQPKGVLHTSGGYLVFASMTHQYVFDYHDGDIYWC
TADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDNSRFWNVIDKHKVNIFYTAPTAIRA
LMQSGDEPVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGDDRCPIVDTWWQTETGGILI
TPLPGATKLKPGSATQPFFGVVPEIVDADGKTLEGETTGNLCLTRSWPGQMRTVYGDHAR
FEQTYFSTYPGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVAHEKVS
EAAVVGFPHDIKGQGIYAYVTLMSGIEPTDDLRKELVTWVRKEIGPIASPDQIQFAPGLP
KTRSGKIMRRILRKIAEDEPGSLGDTSTLADPGVVDDLVKNRQNKRSA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagatctacgacgtccccgcggaatgggccaagcgcgcctgggtcgaccag
gccaagtacaaggacatgtacgcgcgctcgatctcggacccgaacgcgttctgggccgaa
caggccaagcgcatcgactggatgcacgcgccgaccaagatcgagaacgtctccttcgcg
cccggcaacatctcgatcaaatggttcgaggacggcatcctcaacgtcgcccataactgc
atcgaccggcatctgcacaatcgcgccaaccagaccgcaatcatctgggaaggcgacgat
ccctcgcagtcgaagcacatcacctatcaggagcttcacgacgaggtctgccggatggcc
aacatcctgcgcacccgcaacgtcaagaagggcgaccgcgtcaccatctacctgccgatg
attccggaagcggcctacgcgatgctggcttgcgcacggatcggtgcgatccattccgtg
gtgttcgcgggcttctcgcccgatagcctcgcccagcgcatcaacgactgccaatccaag
gtcgtgatcacggcggatgaaggcctgcgcggcggcaagaaggtgccgctgaaggccaat
gtcgacgcggcgctcgccaaggccgacggcgtcgactgggtcgtcgtggtcaagcgcacc
ggcggcaaggtcgacatgaaccccacccgcgacctctggtatcacgaggcggcggcgatg
gtgacgacggagtgccccgccgagcacatgcacgccgaggatccgctgttcattctctat
acgtcgggatcgaccggccagcccaagggcgtgctgcacacctcgggcggctatctcgtg
ttcgcgtcgatgacgcatcaatacgtcttcgactatcacgacggcgacatctactggtgc
acggccgacgtcggctgggtcaccggccacagctacattctgtacggaccgctcgccaac
ggcgcgaccacgctgatgttcgaaggcgtgccgaattacccggataattcgcggttctgg
aacgtcatcgacaagcacaaggtcaacatcttctacaccgccccgacggcgatccgcgcg
ctgatgcagagcggcgacgagcccgtgaagaagacctcgcgcgcgagcttgcgcctgctc
ggctcggtcggcgaacccatcaatccggaagcttgggaatggtatcaccgcgtcgtcggc
gatgaccgctgtccgatcgtcgacacctggtggcagaccgaaaccggcggcatcctgatc
acgccgctgccgggcgcgacgaaactcaagccgggttcggcgacgcagccgttcttcggc
gtggtgcccgagatcgtcgatgccgacggcaagacgctggaaggcgagaccaccggaaat
ctctgcctcacgcgctcctggccgggccagatgcgcaccgtctatggcgatcacgcccgc
ttcgagcagacctacttctcgacatacccgggcaagtatttcaccggcgacggctgccgg
cgcgacgccgacggctattactggatcaccggccgcgtcgacgacgtcatcaacgtctcc
ggccatcgcatgggcacggccgaagtcgagagcgcgctggtcgcgcatgagaaggtctcg
gaagccgccgtggtcggcttcccgcacgacatcaagggccagggcatctacgcctacgtc
accctgatgtccggcattgagccgaccgacgacctgcgcaaggagctcgtcacctgggta
cgcaaggagatcggaccgatcgcctctcccgaccagatccagttcgcgcccggcctgccc
aagacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgccgaggacgagccg
ggcagcctcggtgacacctcgactttggccgatcccggcgtcgtcgatgatctcgtcaag
aaccggcagaacaagaggtcagcgtaa

DBGET integrated database retrieval system