KEGG   Bradyrhizobium sp. S23321: S23_03110Help
Entry
S23_03110         CDS       T01796                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:brs00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:brs00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:brs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318808..320565
Genome map
AA seq 585 aa AA seqDB search
MVKGSALASLIVLCWTSSLSAQTVYPIDRAEILAGAQFDFKVEFPGPVDPARLKVTVNGA
DYAGVFGRAGTFVEREDGKDQSALILRDVTLTRPGSVTVDVSDGTHQRSIAWTVYETGPR
KAKNVILFIGDGMSPAHRVAARILSKGIAEGKSRGKLAIDDMPHMALVATAGSDSIITDS
ANSASAYATGHKSAVNALGVYADRTASPFDDPRVETITSLARRRHGMAIGIVTNTEIEDA
TPAAMVAHTRRRAAYDEIVEQFFAAKPDVLMGGGSANFLPKSATGSKRKDEADYVAKFRD
VGYQVATTASELSAAAAKPEAGRLLGLFATGNMDGVLDRKFLRGGGVKKFPEQPDLTEQV
QAALTILSKNETGFFLMVESGLIDKYAHLLDMERAVYDTIMLDNAVRQTRDWARARGDDT
LILVLADHNHPNSLVGTVNDDMGSTPNVPLRERVGVYEQAGFPNYPAPDAEGYPSRVDVS
RRLAIFSASLPDHYETFRPKLDNPNEPTVKSADDETFKANDKYKDVPGAVLRPGNLSAMI
GASVHSGEDVILTATGPGSERVHGSMDNTEVFRVMVEALGLAAGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagggatcggcactcgcctctctcatcgtcctctgttggacgtcgtcattatcg
gcgcagacggtctatccgatcgatcgcgccgagattctggccggcgcgcaattcgacttc
aaggttgaatttccggggccggtcgatccggccaggttgaaagtgacggtgaacggcgcg
gactatgcaggcgtgttcggccgcgccgggaccttcgtcgagcgcgaggatggcaaggac
cagtcggcgctgatcctgcgtgacgtcacgctgaccaggcccggcagcgtcacggtggac
gtgagcgacggcacgcatcagcgcagtatcgcatggacggtttacgagaccgggccgcgc
aaggcgaagaacgtcatcctgttcatcggcgacggcatgtcgccggcgcatcgggtcgcg
gcccgaatcctgtccaagggcatcgcggagggcaagagccgcggcaagctcgcgatcgac
gacatgcctcatatggcgctggtggcgaccgcgggctcggactcgatcatcaccgattcc
gcgaactcggccagtgcctacgcgaccggccacaagagcgccgtcaacgcgctcggcgtc
tatgcggaccgcaccgccagcccgttcgacgatcccagggtcgaaaccatcaccagcctc
gccaggcggcggcacggcatggcgatcggcatcgtcaccaacaccgagatcgaagacgcg
acgccggctgcgatggtcgcgcacacgcgccggcgcgccgcctatgacgagatcgtcgaa
cagttctttgccgcgaagccggatgtgctgatgggcggcggcagcgctaatttcctgccg
aagtcagcgacaggctccaaacgcaaggacgaagccgactacgtcgcgaagttccgcgac
gtaggctatcaggtcgcgacgaccgcaagcgagctcagcgctgctgccgcaaagccggag
gcgggcaggctgctcgggctgttcgccactggaaacatggatggcgtgctcgaccgcaaa
ttccttaggggcggcggcgtgaagaagtttccggagcaacccgacctgaccgagcaggtg
caggcggcgctgaccatcctctcgaagaacgagactggcttcttcctgatggtcgagtca
ggactgatcgacaaatacgcgcatctgctcgacatggagcgggcggtctacgacacgatc
atgcttgacaatgcagtgcgccagacgcgcgactgggcgcgtgcgcgcggcgacgacacc
ctcatcctggtgctggccgaccacaaccatcccaacagcctggtcggcactgtcaacgac
gacatgggctcgacgcccaacgtgccgttgcgcgagcgcgtcggcgtctatgagcaggcc
ggattcccgaattatccggctccggacgccgagggctatccgtctcgcgtcgatgtcagc
cgccggctcgccatcttctcggccagcctgccggaccactacgagaccttccgcccgaaa
ctcgacaatccgaatgagccgaccgtcaagtccgccgacgacgagaccttcaaggccaac
gacaaatacaaggatgttccgggagcggtgctgcgtcccggcaatctgtcggcgatgatc
ggtgccagcgtgcattcgggcgaggacgtcatcctgacggcgaccgggccgggcagcgag
cgtgtgcatggctcgatggacaataccgaagtcttccgcgtcatggtcgaagcgctcggc
ctcgccgccgggcagtag

DBGET integrated database retrieval system