KEGG   Bradyrhizobium sp. S23321: S23_03110Help
Entry
S23_03110         CDS       T01796                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S23_03110
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    S23_03110
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S23_03110
Enzymes [BR:brs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     S23_03110
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S23_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318808..320565
Genome map
AA seq 585 aa AA seqDB search
MVKGSALASLIVLCWTSSLSAQTVYPIDRAEILAGAQFDFKVEFPGPVDPARLKVTVNGA
DYAGVFGRAGTFVEREDGKDQSALILRDVTLTRPGSVTVDVSDGTHQRSIAWTVYETGPR
KAKNVILFIGDGMSPAHRVAARILSKGIAEGKSRGKLAIDDMPHMALVATAGSDSIITDS
ANSASAYATGHKSAVNALGVYADRTASPFDDPRVETITSLARRRHGMAIGIVTNTEIEDA
TPAAMVAHTRRRAAYDEIVEQFFAAKPDVLMGGGSANFLPKSATGSKRKDEADYVAKFRD
VGYQVATTASELSAAAAKPEAGRLLGLFATGNMDGVLDRKFLRGGGVKKFPEQPDLTEQV
QAALTILSKNETGFFLMVESGLIDKYAHLLDMERAVYDTIMLDNAVRQTRDWARARGDDT
LILVLADHNHPNSLVGTVNDDMGSTPNVPLRERVGVYEQAGFPNYPAPDAEGYPSRVDVS
RRLAIFSASLPDHYETFRPKLDNPNEPTVKSADDETFKANDKYKDVPGAVLRPGNLSAMI
GASVHSGEDVILTATGPGSERVHGSMDNTEVFRVMVEALGLAAGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagggatcggcactcgcctctctcatcgtcctctgttggacgtcgtcattatcg
gcgcagacggtctatccgatcgatcgcgccgagattctggccggcgcgcaattcgacttc
aaggttgaatttccggggccggtcgatccggccaggttgaaagtgacggtgaacggcgcg
gactatgcaggcgtgttcggccgcgccgggaccttcgtcgagcgcgaggatggcaaggac
cagtcggcgctgatcctgcgtgacgtcacgctgaccaggcccggcagcgtcacggtggac
gtgagcgacggcacgcatcagcgcagtatcgcatggacggtttacgagaccgggccgcgc
aaggcgaagaacgtcatcctgttcatcggcgacggcatgtcgccggcgcatcgggtcgcg
gcccgaatcctgtccaagggcatcgcggagggcaagagccgcggcaagctcgcgatcgac
gacatgcctcatatggcgctggtggcgaccgcgggctcggactcgatcatcaccgattcc
gcgaactcggccagtgcctacgcgaccggccacaagagcgccgtcaacgcgctcggcgtc
tatgcggaccgcaccgccagcccgttcgacgatcccagggtcgaaaccatcaccagcctc
gccaggcggcggcacggcatggcgatcggcatcgtcaccaacaccgagatcgaagacgcg
acgccggctgcgatggtcgcgcacacgcgccggcgcgccgcctatgacgagatcgtcgaa
cagttctttgccgcgaagccggatgtgctgatgggcggcggcagcgctaatttcctgccg
aagtcagcgacaggctccaaacgcaaggacgaagccgactacgtcgcgaagttccgcgac
gtaggctatcaggtcgcgacgaccgcaagcgagctcagcgctgctgccgcaaagccggag
gcgggcaggctgctcgggctgttcgccactggaaacatggatggcgtgctcgaccgcaaa
ttccttaggggcggcggcgtgaagaagtttccggagcaacccgacctgaccgagcaggtg
caggcggcgctgaccatcctctcgaagaacgagactggcttcttcctgatggtcgagtca
ggactgatcgacaaatacgcgcatctgctcgacatggagcgggcggtctacgacacgatc
atgcttgacaatgcagtgcgccagacgcgcgactgggcgcgtgcgcgcggcgacgacacc
ctcatcctggtgctggccgaccacaaccatcccaacagcctggtcggcactgtcaacgac
gacatgggctcgacgcccaacgtgccgttgcgcgagcgcgtcggcgtctatgagcaggcc
ggattcccgaattatccggctccggacgccgagggctatccgtctcgcgtcgatgtcagc
cgccggctcgccatcttctcggccagcctgccggaccactacgagaccttccgcccgaaa
ctcgacaatccgaatgagccgaccgtcaagtccgccgacgacgagaccttcaaggccaac
gacaaatacaaggatgttccgggagcggtgctgcgtcccggcaatctgtcggcgatgatc
ggtgccagcgtgcattcgggcgaggacgtcatcctgacggcgaccgggccgggcagcgag
cgtgtgcatggctcgatggacaataccgaagtcttccgcgtcatggtcgaagcgctcggc
ctcgccgccgggcagtag

DBGET integrated database retrieval system