KEGG   Bradyrhizobium sp. S23321: S23_03820Help
Entry
S23_03820         CDS       T01796                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    S23_03820
Enzymes [BR:brs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     S23_03820
   3.1.2  Thioester hydrolases
    3.1.2.-  
     S23_03820
Lipid biosynthesis proteins [BR:brs01004]
 Fatty acid synthase
  Component type
   S23_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384894..385646
Genome map
AA seq 250 aa AA seqDB search
MVSGVVPASEEDSMRVSMVRSYGNSASAVERRYGFFMHIAVLMLALMTIATTASAQAQPA
AKPLKLVVLGDSLSAGLGLSAQGAFPAKLQKALQAKGIAVDMTNAGVSGDTSSGGRDRLD
WSVPDGTDGVIIELGANDALRGIDPDLTRAALTDIVTRLKARRIAVMLCGMLAPPNYGAE
YAARFNSIYPDLAKKFDVPLYPFFLDGVAADAKLNQADGIHPTAAGVDIIVGNILPTAEA
FLRTISEQRS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccggcgtggtgccggcgagcgaagaggattcgatgcgagtgtccatggtccgg
tcatatggcaactccgctagcgcggtcgagaggcgttacggattcttcatgcacatagcc
gtgttgatgctcgctttgatgacaattgcgacgacagcgtcggcacaggcacagccggcc
gccaaaccgctcaagctggtggtcctcggcgattccttgagtgccggcctcggcctctcg
gcccagggagcattccccgcgaagctccaaaaagccttgcaggccaaaggcatagccgtc
gacatgacgaatgccggggtgtctggcgatacgtcctccggcggccgcgaccggctcgac
tggtcggtgcctgacggaactgacggcgtgatcatcgagctcggtgccaacgacgcgctg
cgcggcatcgatcccgatttgacgcgtgccgcgctgaccgacatcgtcacgcgtctcaag
gcgcgcaggattgcggtgatgctgtgcggcatgctggcgccgccgaattacggcgccgaa
tacgcggcgcgcttcaattcgatttatcctgatctggcgaaaaaattcgacgtgccgctc
tatccgttcttcctcgacggtgtcgccgccgacgccaagctcaaccaggccgacggcatt
catccgaccgcggcaggcgtcgacatcatcgtgggcaacatcttgcccacggccgaggca
tttttgcgcaccataagcgagcaacggagttga

DBGET integrated database retrieval system