KEGG   Bradyrhizobium sp. S23321: S23_07750Help
Entry
S23_07750         CDS       T01796                                 

Gene name
fadB
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S23_07750 (fadB)
   01212 Fatty acid metabolism
    S23_07750 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S23_07750 (fadB)
   00650 Butanoate metabolism
    S23_07750 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    S23_07750 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    S23_07750 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S23_07750 (fadB)
   00310 Lysine degradation
    S23_07750 (fadB)
   00380 Tryptophan metabolism
    S23_07750 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S23_07750 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S23_07750 (fadB)
   00281 Geraniol degradation
    S23_07750 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    S23_07750 (fadB)
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     S23_07750 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S23_07750 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     S23_07750 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808432..810645)
Genome map
AA seq 737 aa AA seqDB search
MAYKNFKVETDSDGIALVTWDIPGRSMNVLDETSTNELDAIVKQTTADAAVKGVVITSAK
EAFCAGADLSMLEGMNQAYAKVFGEQGETAANQMLFDQSRRFSLVLRSIETSGKPWAAAI
NGLALGGGFEITLCCHYRVAAENPKTRLGLPEVKVGLFPGAGGTQRVPRLVPPQDAMTIL
LKGDPVTVEKAKALNLIHAVVPAADLVKAAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKA
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTSVLRSKEAAA
MIRSLFLSMQELNKGARRPKDVAPTKVKKIAVIGAGFMGASVGYVSARAGLDVVLIDRDQ
ESADKGKAHAQKVIEEQIKKGRAKPADAEALLARITATADYAALKDVDLVIEAVFEDRKV
KAETFAKAQEHMKPDVIFASNTSTLPITSLAEGFKDQGKFVGIHFFSPVEKMMLVEIIKG
KNTGDVALATALDYVRQIGKTPIVVNDSRGFFANRCVGRYVAEGNEMFLEGVPPAMIENC
AKMAGMPVGPLSLSDEVALDLGLKIMKATEADLGPNAINPDQKKLMVELVEKQGRLGRKN
SKGFYDYPEKGKGQKSLWPGLSALQPKQLDPDTLDVEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHRLEAKYGSRFTPPKLLEEMA
TKGETFYGRFAPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaagaacttcaaggttgagaccgattccgacggcatcgcgctcgtgacctgg
gacatcccgggccgttcgatgaacgtgctcgacgagacctcgaccaacgagctcgacgcg
atcgtcaagcaaaccacggctgatgccgcggtgaagggcgtcgtcatcacctccgccaag
gaagcgttctgcgccggcgccgatctgtcgatgctggaaggcatgaaccaggcctacgcc
aaggtctttggggagcaaggcgagaccgccgcgaaccagatgctgttcgaccagagccgg
cgcttctcgctggtgctgcgttcgatcgagacgtccggcaagccgtgggcggccgcgatc
aacggcctcgcgctcggcggcggcttcgaaatcacgctgtgctgccactatcgcgtggcg
gcggagaatcccaagacccgcctcggtctgcccgaggtcaaggtcggcctgttccccggc
gccggcggcacgcagcgcgtgccgcgcctggtgccgccgcaggacgccatgacgatcctg
ctcaagggcgacccggtgacggtcgagaaggcgaaggcgctgaacctcattcacgccgtc
gttcccgccgccgacctcgtcaaggccgccaaggactggatcaagggcggcggcaaggcc
gtcgcgccctgggacgagaagggcttcaagctcccgggcggtccggtgttctccaaggcc
ggcatgatgatgttcccggccggcaacgcgatctatcgccgcgagacctacgacaactac
ccggccgcgcgcgccatcatgagctgcgtctatgaaggcctgcagttgccgatcgacgct
gccctgcgtgtcgagtcgcgctacttcacctcggtgctgcgctcgaaggaagcggccgcg
atgatccgcagcctgtttctgtcgatgcaggagctcaacaagggcgcgcgccgtccgaag
gacgtggccccgaccaaggtgaagaagatcgccgtgatcggcgccggcttcatgggcgcc
agcgtcggctacgtctcggcccgcgccggcctcgacgtcgtgctgatcgaccgcgaccag
gagagcgccgacaagggcaaggcgcacgcgcagaaggtgatcgaggagcagatcaagaag
ggccgcgccaagcctgccgatgcagaagctctgctcgcgcgcatcacggcgaccgccgac
tatgccgcgctgaaggacgtcgacctcgtcatcgaggccgtgttcgaggaccgcaaggtc
aaggcggagaccttcgccaaggcgcaggagcatatgaagccggacgtgatcttcgcatcg
aacacctcgacgctgccgatcacctcgctggccgaagggttcaaggaccagggcaagttc
gtcggcatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcaagggc
aagaacaccggcgatgtcgcgctcgcgaccgcgctcgattacgtccggcagatcggcaag
acgccgatcgtggtgaacgacagccgcggcttcttcgccaatcgctgcgtcggccgctac
gtcgccgagggcaacgagatgttcctcgaaggcgtgccgccagcgatgatcgagaactgc
gccaagatggccggtatgccggtcggcccgctctcgctctcggatgaagtcgcgctcgat
ctcggcctcaagatcatgaaggccacggaagccgatctcggccccaacgccatcaacccc
gatcagaagaagctgatggtggagctggtcgagaaacagggccgtctgggccgcaagaac
agcaagggcttctacgactaccccgagaagggcaagggccagaagagcctgtggccgggc
ctctcggccctgcagccgaagcagctcgaccccgatacgctcgatgtcgaagagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgtacggtggaagaccacgtcatc
accgatccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgcaccgttcacc
ggcggcacgctgtcctacatcgacttcatgggcacgaagaagttcgtcgagctctgccac
aggctggaagcaaagtacggctcgcgtttcaccccgccgaaactgctcgaggagatggcc
acgaagggcgaaaccttctacggacgcttcgcgccgaagaaggcagcggcctga

DBGET integrated database retrieval system