KEGG   Bradyrhizobium sp. S23321: S23_08010Help
Entry
S23_08010         CDS       T01796                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_08010 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S23_08010 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    S23_08010 (thrC)
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     S23_08010 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
836855..838273
Genome map
AA seq 472 aa AA seqDB search
MTRYISTRGEAPELGFCDVMLTGLARDGGLYVPATWPQLSADTIAGFFGRPYWEVAVDVI
RPFAGGEISDAELGRMANEAYATFRHPAVVPLRQMSPHQFVLELFHGPTLAFKDVAMQLI
SRLMDHVLAKRGQRTTIVVATSGDTGGAAVEAFAGLENVDLVVLFPHGRISEVQRRMMTS
AGAANVHALAIEGNFDDCQALVKAMFNNHRFRDATSLSGVNSINWARIVAQVVYYFTSAV
AVGAPARAVDFVVPTGNFGDIFAGYVAKRMGLPIRTLRIAANVNDILARTLKTGIYEVRE
VHATASPSMDIQISSNFERLMFEAGRRDAAGVRRLMESLKQSGRFVLPDATLAEIREEFD
AGRADETETAAAIRAAWREAGELVDPHTAVALAVADRDTTDTTVPSIVLSTAHPAKFPDA
VEAACGQRPQLPAWLDGLMTKSEHMKVMKNEQGEVERFVLSVSRAAKQGVAG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgactcgttatatctcgacccggggcgaggcccccgaactcggcttctgcgacgtgatg
ctgaccgggcttgcccgcgacggcggcctgtatgtgccggccacctggccgcagctctcg
gccgacaccatcgccggcttcttcggtcgcccctattgggaggtcgcggtcgatgtgatc
cgccccttcgccggcggcgagatttcggacgcggagctcggccgcatggccaacgaggcc
tatgccaccttccgtcacccggcggtggtgccgctgcgccagatgtcgccgcaccagttc
gtgctggagctgtttcacggtccgacgctcgccttcaaggacgtggcgatgcagctgatt
tcgcggctgatggaccacgtgctcgccaagcgcggccagcgcaccaccatcgtggtcgcg
acttccggtgacaccggcggcgccgctgtcgaggcgtttgcgggcctcgagaatgtcgat
ctcgtcgtgctgtttccgcacggccgcatctccgaggtgcagcgccggatgatgacctcg
gcgggtgcggccaacgtccatgcgctcgccatcgaaggcaatttcgacgactgccaggcg
ctcgtgaaggcgatgttcaacaaccatcgtttccgcgatgcgacctcgctgtccggcgtc
aattccatcaactgggcacgcatcgtcgcgcaggtcgtctactacttcacctcggccgtt
gccgtcggtgcgccggcgcgtgcggtggatttcgtcgtgccgaccggcaatttcggcgac
atctttgcaggctatgtcgccaagcgcatgggtcttccgatccgcaccctgcgcatcgcc
gccaacgtcaacgacatcctggcgcgtacgctcaagaccgggatctacgaggtgcgcgag
gtgcacgcgaccgcgtcgccgtcgatggacatccagatctcctcgaatttcgagcggctg
atgttcgaagccggccggcgcgacgccgccggcgtgcgccgcttgatggagtcgctgaag
cagtccggacggttcgtgctgcccgacgcgacgctggccgagatccgcgaggagttcgac
gcaggtcgcgccgacgagaccgagaccgcggctgcgatccgcgccgcctggcgcgaggcg
ggtgagctggtcgatccccacaccgcggtcgcgctcgcggtcgccgaccgcgacaccacc
gatacgacggtccccagcatcgtgctctcgacggcccatccggccaaattccccgatgcg
gtcgaggcggcctgcggccagcggccgcaactgccggcctggctcgacggtctcatgacc
aaatccgaacacatgaaggtgatgaagaacgagcagggcgaggtcgagcggttcgtgctg
tcggtcagccgcgccgcgaaacagggagttgccggatga

DBGET integrated database retrieval system