KEGG   Bradyrhizobium sp. S23321: S23_10380Help
Entry
S23_10380         CDS       T01796                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S23_10380 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S23_10380 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    S23_10380 (glcB)
Enzymes [BR:brs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     S23_10380 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098895..1101060)
Genome map
AA seq 721 aa AA seqDB search
MKRVDAHGLKIAPVLFDFIAKEAAPKTGIAPDAFWAGVAAIIKELGPKNRALLTLRDTLQ
AKIDDWHRANKGKAFDLEAYTAFLKEIGYLVPEPATQKVETANVDEEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDPSEAGKGYNKARGDKVIAKAKTFLDAAVPL
ATGSHTDVTAYSIVAGQLAVKLKSGNATALKNAAQFAGFQGDAAAPSAVLLANNGLHVEV
KIDRSSTIGKDDPAGVADMIMESAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRSLNADRSYKTPDGKGEVKLHGRSLLLMRNCGHHMFTDAVLDETGEEVPE
GLLDAAVSGLLAIHDLTGNSKVKNSRTGSAYIVKPKMHGPDEVSLACEIFDRVEKMLSLP
ENTLKIGIMDEERRTTVNLKACIQRASKRIMFINTGFLDRTGDEIHTSMEAGPMIRKNEM
KAQAWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLQQKLAHPQAGATTAWVP
SPTAATLHALHYHQVNVIARQQELTKGGPRAKLSDILTIPVSKSNWAPDDVKQEIDNNCQ
GILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQGVITEAQVMESLK
RMAVVVDKQNAGDAIYKPMAPSFDGVAFKAACDLIFKGREQPNGYTEYILTARRREAKAA
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtcgacgcccacggattgaagattgcacccgtcctgtttgacttcatcgcc
aaggaagcggccccgaaaacggggatcgcgccggatgcgttctgggccggggttgccgcc
atcatcaaggagctggggccgaagaaccgcgcactgctgacgttgcgggacacgctgcag
gccaagatcgacgactggcaccgcgccaacaagggcaaggcgttcgacctcgaggcctat
accgccttcctcaaggagatcggctatctcgtccccgagcctgcgacgcagaaggtcgag
accgccaacgtggacgaggagatcggcaagatctgcggcccgcagctcgtcgttccgctc
accaatgcgcgctatgcgctgaacgcggcgaacgcgcgctggggctcgctctacgacgcc
ttctacggcaccgacgcgatcccgcacgatccttccgaagccggcaagggttacaacaag
gcgcgcggcgacaaggtgatcgccaaggccaagaccttcctcgatgccgccgtgccgctt
gcgaccggcagccataccgatgtcaccgcctatagcatcgttgccggccagctcgccgtg
aagctaaagagcggcaacgccaccgcgctgaagaacgccgcgcagttcgcgggcttccag
ggcgatgcagccgcgccgagcgcggtgctgctcgccaacaatggcctgcacgtcgaggtc
aagatcgaccgcagcagcacgatcggcaaggacgatccggccggcgtcgccgacatgatc
atggagtccgccgtgtcgaccatcctcgacatggaggactcggtcgcggcggtcgacgcc
gaagacaaggtgctggtctatcgcaacacgctcggcctgatgaacggcacgctgtcggcc
gacttcgagaagggcggcaagacgctgacgcgttcgctgaatgccgaccgcagctacaag
acgccggacggcaagggcgaggtgaagctgcacggccgcagcctgctgctgatgcgcaat
tgcggtcaccacatgttcacggacgctgtgctggacgagaccggcgaggaagttccggaa
ggcctgctcgatgccgcggtctccggcctgctcgcgattcacgacctcacgggcaactcg
aaggtcaagaacagccgcacgggatcggcctatatcgtcaagccgaaaatgcacggcccg
gacgaagtctcgctcgcctgcgagatcttcgaccgcgtcgagaagatgctctcgctgccc
gagaacacgctcaagatcggcatcatggacgaggagcggcgcaccaccgtcaacctcaag
gcctgcatccagcgtgcctccaagcgcatcatgttcatcaacaccggcttcctcgaccgc
accggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatg
aaggcgcaggcctggatcaaggcctatgaggactggaatgtcgacatgggcctgatcgac
ggcctgcccggccacgcccagatcggcaagggcatgtgggctgcgcccgacaagatggcg
gacatgctgcaacagaagctcgcgcatccgcaggccggtgccaccaccgcctgggtgccc
tcgccgaccgctgcgacgctgcacgcgctgcattatcaccaggtcaacgtcatcgcccgc
cagcaggagctgaccaagggcggcccccgcgcgaagctctccgatatcctcaccattccg
gtatcgaagtcgaactgggcgcccgacgacgtcaagcaggagatcgacaacaattgccag
ggtatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgcct
gatatccacgacgtcggcctgatggaagaccgcgccaccttgcgcatctcaagccagcat
ctcgccaactggctgcaccagggcgtgatcactgaagcgcaggtgatggaatcgctcaag
cgcatggccgtcgtcgtcgacaagcagaacgcgggcgatgcgatctacaagccgatggcg
cccagcttcgacggcgtcgccttcaaggccgcatgcgacctgatcttcaagggacgtgag
cagccgaacggctacaccgaatacatcctcaccgcccgccgccgcgaggcgaaagcggcc
ggctga

DBGET integrated database retrieval system