KEGG   Bradyrhizobium sp. S23321: S23_10690Help
Entry
S23_10690         CDS       T01796                                 

Gene name
exoN
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S23_10690 (exoN)
   00052 Galactose metabolism
    S23_10690 (exoN)
   00500 Starch and sucrose metabolism
    S23_10690 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    S23_10690 (exoN)
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     S23_10690 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133822..1134697
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVYDEAREAGIEHFIFVTGRNK
NVIEDHFDKMFELDATLAARGKKTEQDILAQNQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGNEPFAVVLPDELVLNTTGCLKQMIETASTLGEKSNVIAVEAVPDHLTHQYGICGVGKR
TGKMFEVDGMVEKPAKGTAPSNLSITGRYILQPEIFKILETQERGAGGEIQLTDAMIGLA
RSQKFYGVEFEGERHDCGSKPGFLRANIAYGLQRPELRDGLIAEMKKYLGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtattccccgtcgccggcctcggcacccgcgtactgcccgcc
accaaggcgatgcctaaggaaatgctgaccatcgtcgacaagccgctgatccagtacgtc
tatgacgaggcgagggaagccggcatcgagcatttcatcttcgtcaccggccgcaacaaa
aacgtcatcgaagatcatttcgacaagatgttcgagctcgacgcgacgcttgccgcgcgc
ggcaagaagacagagcaggacatcctggcgcagaaccagccggaggccggcgccgtcagc
ttcacgcgccagcaggccccgctcggccttggtcacgcggtctggtgcgcgcgcgacatc
gtcggcaacgagccgttcgcggtcgtgctgcccgacgagctcgtgctcaacaccaccggc
tgcctgaagcagatgatcgagacggcgtcgacgctcggcgaaaaatccaacgtcatcgcg
gtcgaggcggtgcccgaccatctcacccatcaatacggcatctgcggcgtcggcaaacgc
accggcaagatgttcgaggtcgacggcatggtcgagaagccggccaagggcaccgcgccc
tccaacctctcgatcaccggccgctacatcctgcagccggaaatcttcaagattctcgag
acacaggagcgcggcgccggcggcgagatccagctcaccgacgccatgatcgggcttgcc
aggtcgcagaaattctacggcgtcgagttcgaaggcgagcgccatgattgcggctccaag
cccggctttctccgcgccaacatcgcctacggcctgcagcggccggaattgcgcgacggg
ctgatcgcggagatgaagaagtatctggggcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system