KEGG   Bradyrhizobium sp. S23321: S23_11730Help
Entry
S23_11730         CDS       T01796                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:brs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:brs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238356..1239519)
Genome map
AA seq 387 aa AA seqDB search
MSPNAPADHQHDDVMYPSAIPFVLVHLGCFAAFWSGVTWQAVAICVSLYVVRMFAIGAGY
HRYFSHKSFATGRVFQFILACLAQSTAQKSVLWWAAKHRHHHLHSDTELDVHSPRQRGFL
YSHLGWIFYREHDATDLVKVGDLAVYPELMWLHRLELLPAFILAALCFLVAGWSGLVVGF
LWSTVLVYHATFCINSLAHVHGRKRYVTGDDSRNNWLLALFTMGEGWHNNHHAYQSSVRQ
GFRWWEIDVTFYILKVLSWFGIVWNMKAPPEQVLRNEQPLGARVINRAARDLAARFDAQT
LAHAISSARRRADLAQMQLPTLQDILNRAHEGVDALTHLHLPKIPTRDEFLAEARAMFAR
TRSLNEIVDHAYEYFLASVRAQLATAS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaacgcgcccgccgaccaccagcacgacgacgtcatgtacccctccgcaata
ccgttcgtgctggtccatctcggctgctttgcagccttctggtcaggcgtcacctggcag
gccgtcgcgatctgcgtttcgctgtatgttgtgcgcatgttcgcaatcggagcgggttac
caccgctatttctcgcacaagtctttcgcgaccggacgggtatttcagttcatcctggcc
tgcctcgcgcagagcaccgcgcagaagagcgtgttgtggtgggcggcaaagcatcggcac
catcatctgcattccgataccgaattggacgtgcattcgccgcgtcagcgcggcttcctg
tacagccatcttggctggattttttaccgggagcacgacgcgactgacctcgtgaaagtc
ggcgatcttgctgtctatcccgagctgatgtggctgcatcggctggagctgctgcccgcc
tttatacttgccgcgctctgctttttggtcgcggggtggtcgggcctggtcgtcggcttc
ctgtggagcacggtgctggtctatcacgcgaccttctgcatcaactcgctcgcgcatgtg
catggacgcaagcgctacgtgacgggcgacgattcccgcaacaactggctgctggcgttg
ttcaccatgggtgagggctggcacaacaatcaccacgcctaccagagcagcgtacggcaa
ggcttccgctggtgggaaatcgacgtgaccttttacatcctgaaggtcctgtcctggttc
ggcatcgtctggaacatgaaggcgccgcccgaacaggtgctgcgcaacgagcagccgctc
ggcgcacgggttatcaatcgggcggcgcgcgatcttgccgcacggttcgatgcgcagacg
ctcgcgcacgcgatttcgtcggcgcggcgccgggccgacctcgcccagatgcagttgccg
acgctgcaggacatcctcaaccgggcccatgaaggcgtcgatgcgctgacacatctgcat
ctgccgaagataccgacccgggatgagtttctcgccgaggccagggcgatgttcgcgcga
acccggtccctcaacgagatcgtggaccacgcctacgaatacttcctggcatcggttcgc
gcgcagctcgccacggcgagttga

DBGET integrated database retrieval system