KEGG   Bradyrhizobium sp. S23321: S23_15450Help
Entry
S23_15450         CDS       T01796                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S23_15450 (glgB)
Enzymes [BR:brs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     S23_15450 (glgB)
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S23_15450 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1627879..1630026)
Genome map
AA seq 715 aa AA seqDB search
MPKLPAEAYAIIEGRHSDPFHYLGLHPEGDTSVVRAFLPEASNVEAVGEHGEVAQLDRVH
DAGLFIGALPNGSKRYQLRARFGDKFVELEDAYRFPPILTDFDLYLLGEGTHQRLYDKLG
AHPMTLDNVEGIGFVVLAPNARRVSVVGDFNFWDARRHPMRVRGNGYWELFIPHAKAGDH
YKFDIIGPHGHQLPQKSDPMAFASEVRPKTASIVFDEAHLPRPRPAPDGINALSAPMSIY
EVHLGSWRRKNGGEWLTYRELAEQLPAYARDMGFTHLEFLPVSEHPFDGSWGYQPTGLYA
PTSRFGTPEDFAALVDACHREGVGVLLDWVPGHFPDDPHGLGSFDGTSLYEHANPLQGRH
LDWGTLIYNYGRTEVTNFLVSNALFWLERYAIDGLRVDAVASMLYLDYSRPPGGWIPNQY
GGRENIEAIAFLRRVNTELFARFPQATTAAEESTSWPQVSRPVEFGGLGFGYKWNMGWMH
DTLNYISKDPIHRKHHHGDILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDEWQRF
ANLRAYYSFMFGHPGKKLLFMGNEIAQSREWNHDQSLDWHLLEYKNHSGIQSLIRDLNRL
YRAVPALHQMDCDQAGFEWLITDDANRNVFAWLRKGIDAHARCLVIVNFSPNVYRNYRVP
VPLAGKWKEVFNSDSAHYGGTNVGNIGEVHAVDGKAPELRLTIPPLAAIFLVPES
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaactacccgccgaggcctacgcgatcatcgagggtcgccactccgatcccttc
cattatcttgggttgcatcccgagggcgacacgagcgtggtgcgtgccttcctgccggag
gcctcgaacgtcgaagcggtcggcgagcatggcgaggttgcgcaactcgatcgcgtccac
gacgccggccttttcatcggcgccctgcccaacggctcgaagcgctaccagctccgcgcc
aggttcggcgacaaattcgtcgagctcgaggacgcctaccgctttccgccgatcctgacc
gacttcgatctctatctgctcggcgaaggcactcatcagcgcctctatgacaagctcggc
gcgcatccgatgacgctcgacaacgtcgagggcatcggcttcgtggtgctggcaccgaat
gcgcggcgcgtgtccgtggtcggcgatttcaatttctgggacgcgcggcgccatccgatg
cgggtgcgcggcaacggctattgggaattgttcatcccgcacgccaaggccggcgaccac
tacaagttcgacatcatcggaccgcacggccatcagcttccgcagaaatccgatccgatg
gcgttcgcgagcgaggtccgcccgaagaccgcctccatcgtgttcgacgaggcccatctg
ccgcgtccgcgtccggcgcccgacggcatcaacgcgctgtctgcgccgatgtcgatctac
gaggtccatctcggctcctggcggcgcaagaacggcggcgaatggctgacctatcgcgaa
ctcgccgaacaattgccggcctatgcccgcgacatggggttcacccatctggaattcctg
cccgtcagcgagcatccgttcgacggctcctggggttatcagccgaccggcctctatgcg
ccgaccagtcgcttcggcacgccggaggatttcgccgcgctggtcgatgcctgccaccgc
gagggcgtcggcgtgctgctagactgggtgcccggccatttcccggatgatccgcacggg
ctcggcagctttgacggcacctcgctctacgagcacgccaacccgctgcagggccgccat
ctcgactggggcacgctaatctacaattacggccgcaccgaagtaaccaacttcctggtg
tcgaatgcgctgttctggctggagcgctacgccattgacggcctgcgcgtcgacgccgtg
gcatccatgctctatctcgactacagccggccgcccggtggctggatcccgaaccaatat
ggcggccgcgagaacatcgaggcgatcgcgttcctacgccgtgtcaacaccgagctgttc
gctcgcttcccgcaggccaccaccgcggcggaagaatccacctcgtggccgcaggtctcg
cgcccggtcgaattcggcggcctcggcttcggctacaagtggaacatgggctggatgcac
gacacgctgaattacatcagcaaggatccgatccaccgcaagcatcatcacggcgacatc
ctgttcggcctgcactacgccttctcggaaaacttcatcctgccgctgtcgcatgacgag
gtcgtgcacggcaagcgatcgatcctcggccgcatgcccggcgacgaatggcagcgcttt
gcgaatctgcgcgcctattacagcttcatgttcggccatcccggcaagaagctgctgttc
atgggcaacgagatcgcgcagagccgcgaatggaatcacgaccagtcgctcgactggcac
ctgctggaatacaagaaccactccggcattcagtcgctgatccgcgatctcaaccggctc
tatcgcgccgtgccagccctgcaccagatggattgcgaccaggccggcttcgaatggctg
atcaccgatgacgccaaccgcaacgtgttcgcttggctgcgcaaggggatcgacgcgcat
gcacgctgcctcgtcatcgtcaacttctcgcccaacgtctaccgcaactaccgcgtcccc
gtcccgttggcgggcaagtggaaagaagtgttcaattcggactccgcccattatggcggc
accaatgtcgggaacatcggcgaagttcatgccgttgacggcaaggcgcccgagctccgc
ctcaccattccgcctctcgccgcgatcttcctcgttccggaaagctga

DBGET integrated database retrieval system