KEGG   Bradyrhizobium sp. S23321: S23_15480Help
Entry
S23_15480         CDS       T01796                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S23_15480
Enzymes [BR:brs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     S23_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635473..1637434
Genome map
AA seq 653 aa AA seqDB search
MDLLAQAQIKGVQSEFVDALGKLRVTDPVALKSILDALPEKRVYRFVQGPVVVRALRHSR
TELAAIGAPPLKWTITGNGNLIAQGETREPVIAWPADLPLGYHRLTLTDAEGATEDVPMI
VAPERAFGGDFDRGWLLAVQLYSIRSDRNWGIGDFTDLAGLVRLAKQLGADGVGLNPLHV
LFDNHPADCSPYSPNSRLFLNPLYIDVEAIPEFSADLVPDAAANAARLREGDRVPYADMA
ALKWRALRAAFDAFVTKASGVRRNDFDAFRADRAPLLSRFACFEVLRHRFVSPWWEWPAE
WQQPDDTKCAELRDGPDKEEVEFVEFVQWTADSQLHAAKALASQLGMRVGLYLDVAVGVQ
SNGFDAWNEQVAISRHLAVGAPPDVLNTAGQDWGLAGFNAGGLEAQSFVPFADMLAASMR
HAGAIRIDHVLGLKRLYLVPRGFKPDNGAYVQMPFEALLGAIARESVAHKCIVIGEDLGT
VPEGFRETMQDFGIWSYLVMMFERDEAGHFRNSDFYRPNALVTLNTHDLCTYAGWRSFSD
LKVKLSLGLDPGESEQARWDALGMLDEILRQNGITANDLYSVLAFLSRTPSRLLAVSLED
LLGVLDQPNIPGTIDEHPNWRQRLPVALDKIAAKVDLAALKAATRERSLIGGS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttagctcaagcccagatcaagggcgttcagtccgaattcgtcgatgccctc
ggaaagctgcgggtcaccgatcccgtggccctcaaatccatcctcgatgccctgccggag
aagcgggtttatcgctttgtccaggggcccgtggtggtgcgtgcactcaggcattcgcgc
accgagctggcggccattggcgcgccgccgctcaaatggacgatcaccggcaacggcaat
ctgatcgcgcagggcgagacacgcgagcccgtgatcgcctggccggccgacctgccgctc
ggctatcaccgtttgacgctgaccgatgccgaaggtgccacggaagacgtgcctatgatc
gtggcgcccgagcgtgccttcgggggcgatttcgaccgcggctggctgctcgccgttcag
ctttacagcatccgctcggaccgcaactggggcatcggcgatttcaccgatctggccggt
ctggtccggctggccaagcaactcggcgccgacggcgtcggactcaatccgctgcatgtc
ctgttcgacaaccatccggccgattgcagcccctattcgccaaacagccggctatttctc
aatccgctctatatcgacgtcgaggccattcctgaattctcggcagacctcgtgccggat
gccgcggcgaacgccgcgcggctgcgcgagggggaccgcgtcccctatgccgacatggcg
gcgctgaaatggcgggccttgcgtgccgcctttgacgctttcgtgacaaaggcgagcggc
gtccgccgcaacgatttcgacgcttttcgcgctgaccgcgcgcccctgttgtcccgcttc
gcctgcttcgaggtgctacgccatcgtttcgtgtcaccgtggtgggaatggccggcggaa
tggcaacagcccgacgacaccaaatgcgctgagttgcgcgatggtccggacaaggaggaa
gtcgagttcgtcgaattcgtgcagtggacggccgacagccaattgcacgccgccaaggcg
cttgccagccagctcggcatgcgggtcgggctctatctggacgtcgccgtcggcgtgcag
tccaacggcttcgatgcctggaatgagcaggtcgcgatctcgcggcatcttgcggtcggc
gcgccgcccgacgtgctcaacaccgccggtcaggactggggtctcgccggtttcaatgcc
ggtggcctggaagcgcagtccttcgtgccgttcgccgacatgctggcggcctcgatgcgc
catgccggcgccatccggatcgatcacgtcctggggctgaagcggctttatctggtgccg
cgcggcttcaagcccgacaacggcgcctatgtgcagatgccgttcgaggcgctgctcggc
gccattgcccgcgaaagcgtggcgcacaaatgtatcgtgatcggcgaggatctcggcacc
gtcccggaaggtttccgcgagaccatgcaggatttcggcatctggtcctacctggtcatg
atgttcgagcgcgacgaagccggacatttccgcaactccgacttctaccggcccaacgcg
ctggtgacgctgaacacgcacgacctctgcacctatgcgggctggcgttccttcagcgac
ctcaaggttaagctctcgctcggactcgatcccggcgagagcgagcaggcgcggtgggat
gctcttggcatgctcgacgagatcctgcgccagaacggcatcaccgccaacgacctctat
tcggtgctcgccttcctgtcgcgcacgccgtcgcggctgttggcggtatcgctggaggat
ctgctcggcgtgctcgaccagcccaatattcccggcacgatcgacgagcatccgaactgg
cgccagcgcctgcctgtcgcgctcgacaagatcgccgcgaaggtcgatctcgcggctttg
aaggcggcgacgcgggaacgttccctcatcggcggaagttga

DBGET integrated database retrieval system