KEGG   Bradyrhizobium sp. S23321: S23_15830Help
Entry
S23_15830         CDS       T01796                                 

Definition
putative decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S23_15830
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S23_15830
Enzymes [BR:brs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     S23_15830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671908..1673260)
Genome map
AA seq 450 aa AA seqDB search
MANAFFSDLLATISERGRTLLRRGDGADIKQDADGLIELCGALLSGRGEASGTALAREVL
DIYQELDAAGRRAFFDGLVRDFGPDRERLSKAIEKWRAKPSDEDASALHFASEPRRQELI
RRLNRAPGGTGDLVNMRADLLGMMKGHADLAALDRDVSHLLSSWFNRGFLVLRRIDWSTP
ANILEKIIRYEAVHEISDWDDLRRRLDPVDRRCYAFFHPAMVDEPLIFVEVALTETIPGA
IQPLLAVDRQHLPIARARTAVFYSISNTQRGLGGISFGSFLIKQVVEELRRELPKLDTFV
TLSPVPGFMQWVKQDKDLPLTDEDREVLKRLDDPKWFENPETTTLLRAVIEPLAAHYFLK
ARTPKGRLIDSVARFHLGNGARLERINWLGDLSPKGLRESAGVMVNYLYRLDDIEKNHEA
YANDGEVVASSAVKKLLKGEGRRLLDMRLS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgccttcttctccgacctgctcgccaccatctccgagcgcggccgcacgctg
cttcggcgcggcgatggcgcggacatcaaacaggacgccgacgggctgatcgagctctgc
ggcgcgctgctgtcgggccggggcgaagcctccggcaccgcgcttgcgcgtgaggtgctg
gatatctaccaggagttggatgcggcaggacgccgcgcctttttcgatggcctcgtgcgt
gatttcgggccggaccgggaacgcctgtcaaaggccatcgagaagtggcgcgccaagccc
agcgacgaagacgcaagcgcactgcatttcgcctcggagccacggcggcaggaactgatc
cgccgcctcaaccgtgcaccgggcggcaccggcgatctcgtcaacatgcgggccgatctg
ctcggcatgatgaagggccacgccgaccttgccgcgctcgatcgcgacgtctcgcatctg
ctgtcttcgtggttcaacagggggtttctcgtgctgcgccggattgactggtcgaccccg
gccaacatcctcgaaaagatcatccgctacgaagccgttcacgagatcagcgactgggac
gatttgcgccgccgcctcgatccggtcgatcgccgctgctacgccttcttccatcccgcg
atggtggacgagcccctgatcttcgtcgaggtggcactgaccgagacgattccgggcgcg
attcaacccctgctcgcggtcgaccgccagcatctgccgatcgcgcgcgcccgcaccgcc
gtgttctattcgatctccaacacccagcgcggcctggggggcatctcgttcggcagcttc
ctgatcaagcaggtggtcgaggagctgcgccgcgaattgccgaagctcgacaccttcgtg
acgctgtcaccggtgccgggcttcatgcagtgggtgaagcaggacaaggatttgccgctg
acggacgaggaccgcgaggtcttgaagcgcctcgacgatcccaaatggttcgagaacccc
gagacgacaacgctgctgcgcgccgtgatcgagccgctcgccgcgcattacttcctgaag
gcgcgcacgccgaagggccggctgatcgattccgtcgcgcgtttccatctcggcaacggc
gcccggctggaacgcatcaactggctcggcgacctctcgccgaagggcctgcgcgaatcc
gccggcgtgatggtcaactacctctaccgcctcgacgacatcgagaagaaccacgaagcc
tacgccaatgacggcgaggtcgtggcgtcgagcgcagtgaagaagctgctgaagggtgaa
gggcgccggctgctggatatgcggctgtcgtag

DBGET integrated database retrieval system