KEGG   Bradyrhizobium sp. S23321: S23_16720Help
Entry
S23_16720         CDS       T01796                                 

Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S23_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-ProteinID: BAL74889
UniProt: I0G2A2
Position
complement(1757023..1757445)
Genome map
AA seq 140 aa AA seqDB search
MQSHSQTSPGIWLRAIAGAGALTLLLSAPASLAQQPASDEGAQQAFNNSCRTCHSVKEGD
NRLGPNLHNIVGRKAGALPDYNYSPSMKEAGFVWDQDKLTRFMVKPDEIVSGNKMQPYGG
ISADEAAKVAAYLQAAGGSQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcacactcgcagacatcgccaggcatatggctgcgcgcgatcgcaggcgccgga
gcattgacgctgctcctctccgcgcccgcctcgctcgcgcagcagccggcgagcgacgag
ggcgcccaacaggccttcaacaattcctgccgcacctgtcactcggtgaaggagggcgac
aaccgcctcggccccaacctccacaacatcgtcggccgcaaggccggcgcgctgccggac
tacaactactcgccctcgatgaaagaggccggcttcgtctgggaccaggacaagctcacg
cgcttcatggtcaagccggacgaaatcgtgtccggcaacaagatgcagccctatggcggc
atctcggcggatgaagcggcgaaggtggctgcatatctacaggcggcgggcggctcgcaa
tag

DBGET integrated database retrieval system