KEGG   Bradyrhizobium sp. S23321: S23_16720Help
Entry
S23_16720         CDS       T01796                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:brs00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:brs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1757023..1757445)
Genome map
AA seq 140 aa AA seqDB search
MQSHSQTSPGIWLRAIAGAGALTLLLSAPASLAQQPASDEGAQQAFNNSCRTCHSVKEGD
NRLGPNLHNIVGRKAGALPDYNYSPSMKEAGFVWDQDKLTRFMVKPDEIVSGNKMQPYGG
ISADEAAKVAAYLQAAGGSQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcacactcgcagacatcgccaggcatatggctgcgcgcgatcgcaggcgccgga
gcattgacgctgctcctctccgcgcccgcctcgctcgcgcagcagccggcgagcgacgag
ggcgcccaacaggccttcaacaattcctgccgcacctgtcactcggtgaaggagggcgac
aaccgcctcggccccaacctccacaacatcgtcggccgcaaggccggcgcgctgccggac
tacaactactcgccctcgatgaaagaggccggcttcgtctgggaccaggacaagctcacg
cgcttcatggtcaagccggacgaaatcgtgtccggcaacaagatgcagccctatggcggc
atctcggcggatgaagcggcgaaggtggctgcatatctacaggcggcgggcggctcgcaa
tag

DBGET integrated database retrieval system