KEGG   Bradyrhizobium sp. S23321: S23_19040Help
Entry
S23_19040         CDS       T01796                                 

Gene name
bchI
Definition
magnesium chelatase subunit BchI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:brs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999216..2000238
Genome map
AA seq 340 aa AA seqDB search
MATAFPFSAIVGQDEMKLALLIAAVDPKVGGVLAFGDRGSGKSTAVRALAALLPKMKVVV
GCRYNCDPDRPAEFCEECRVRADKGALKSAQVPVPVVDLPLGATEDRVVGALDLERALAR
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDNLADRIEVVRRRDAFETDSAAFVTNWAKDEA
RLRKKIIGAREKLSSVSVPDVTLERAAKLCMALGTDGLRGELTLMRAARALAALDSAKTV
TDHHLRRIAPSALRHRLRRNPLDDAGSSVRVDRAISEVLG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagcgtttccattctccgcgatcgtcgggcaggacgagatgaagctcgcgctg
ctgattgccgcggtcgatcccaaggtcggcggcgtgctggcctttggcgatcgtggatcg
ggcaagtccacggcggtccgcgcgcttgcggcgttgctgccgaagatgaaggtcgttgtc
ggctgccgctataattgcgatccggatcggccggcggaattttgcgaggagtgtcgtgtt
cgcgccgacaagggcgcgctgaaatctgcgcaagtgcctgttccggtggtcgatctaccg
ctgggcgcgaccgaggatcgcgtcgtcggggcgctcgatctggaacgagccttggcgcgc
ggagagaaagcgttcgagccgggactgctggcccgcgcgcatcgcgggttcctgtacatc
gacgaagccaatctgctggaggaccacctcgtcgacctcctgctcgatgtcgccgcctcc
ggtgaaaatgtcgtcgagcgagagggcttgagcatacgccatccggcgcggttcgtgctg
gtcgggacgggaaaccccgaggaaggcgagttgcgcccgcaattgctggatcgcttcggc
atgtcggtggaggtgaagacacccgacaatctcgcggaccggatcgaggtcgtgcggcgc
cgggacgcctttgaaaccgatagcgcagcctttgtcacgaattgggccaaggacgaggcc
aggcttcgcaagaagatcatcggagcgcgggagaaactctcctcagtctcggtgcccgat
gtgacgctcgagcgcgccgcaaagctctgcatggcgcttggcaccgacggcttgcgtggc
gaactgaccttgatgcgcgcggcccgtgcgctcgcggcactcgactccgccaagaccgtg
accgaccatcacctgcgccggatcgcgccttcggccttgcggcatcgtttgcggcgcaat
ccgctcgatgatgccggctcctcggtacgggtcgatcgcgcgatatcggaggtgctggga
tga

DBGET integrated database retrieval system