KEGG   Bradyrhizobium sp. S23321: S23_19050Help
Entry
S23_19050         CDS       T01796                                 

Gene name
bchD
Definition
magnesium chelatase subunit BchD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S23_19050 (bchD)
Enzymes [BR:brs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     S23_19050 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000235..2001989
Genome map
AA seq 584 aa AA seqDB search
MIGAAVWPDAVTAARLFAVDPPGTGGVLLRSRAGPVRDRWLAVLRAALPRSENVKQVPLN
IAEGRLLGGLDLNATLLAGRPVAERGLLAEADGGVIMLAMAERLSAATTVHVTAAMDAGE
TIVERDGLSLRMPARFGVIAIDEGLEDEFAPASLRDRLAFHLDLNAIGVRDAEEFAPDAG
ETVAARVKLPSLKAEAAQIEALCTAATALGITSLRAPMLALRIACASAALAGHSRVEQED
LALAARLVLAPRALVFPPADEAAPPEPPPPTEDEANESGGEDQISDIDRALDEVILAAVQ
AAIPLDVLATLRAGAAGRSRSRSSGKAGALQKSSKRGRPAGVLRGALRAGARLNVIETLR
AAAPWQALRRREAAGSAAESRPRILIRKDDFRISRFKQRTETVTIFVVDASGSAALHRLA
EAKGAVELLLADCYIRRDQVALIAFRGSAAEMLLPPTRSLARAKRSLAGLPGGGGTPLAA
GLDAAFVLSDSIRRKGQMPTVIVLTDGRANIARDGGQGRPRAEDDAMSAARQLRAAGIAI
VLVDTSPRPGVSGEAIAKEMGARYLPLPHADAATLSKAVLASVG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgccgccgtctggcccgacgcggtgacggcggcgcgattgttcgccgtggac
ccgccggggaccggcggcgtgttgttgagatcccgcgcgggcccggtgcgtgatcgttgg
ctcgccgtgcttcgtgcggcattgccgcgatccgaaaatgtgaagcaggtgccgctgaat
attgccgaaggccggctgctaggtgggcttgacctcaacgcgacgctgctggcgggccgg
cccgttgccgaacgcggcctcctggcggaagccgatggcggcgtgatcatgctggcgatg
gccgaacggctgtccgcagcaaccacggtccatgtcaccgccgcgatggacgccggggag
acgattgtcgagcgcgacggcctgtcgcttaggatgcctgcgcgtttcggtgtcatcgcc
atcgacgaaggccttgaggatgaattcgcgccggcgtcgctgcgcgatcgtttggcgttt
cacctcgatctcaacgcaatcggcgtccgtgacgccgaggaattcgcgcctgatgccggg
gaaacagtggcggcacgcgtgaagctgccatccctcaaggccgaagcggcccagatcgag
gccctctgtaccgcggccacagcgcttgggatcacctcgttgcgtgcgccaatgctggcg
ctgcgtatcgcctgcgcaagtgccgcgctcgcaggtcattccagagtcgaacaggaggat
ctcgctctggctgcgcggttggtgctggcgccccgcgcgctggtgtttccgccagcggat
gaggcggccccaccggagccaccgccgccgactgaggatgaagctaatgagtccggtggc
gaagatcaaatctccgacatcgatcgcgcgctcgacgaggtcattctggccgcagtgcag
gcggcaatcccactggatgtgctggcaacgcttcgtgcgggggctgccggacgatcgcgc
agtcgttcctccggcaaggccggcgccttgcagaagtccagcaagcggggccggccggcc
ggcgtgctgcgcggtgcgttgcgtgccggcgccaggctcaacgttatcgaaaccctgcgc
gcggcagcgccatggcaggctttgcggcgccgtgaggcagcgggatcggccgcggaatcc
cgtccccgcattctgatccgcaaggatgacttccgcatctcgcggttcaagcagcgcacg
gaaacggtcacgatcttcgtggtcgacgcgtccggctcagcagcgttgcatcggctggcg
gaagccaagggcgcggtcgaattgctgctggcggattgctatattcggcgggatcaggtg
gcgttgattgcgtttcgcggcagtgccgccgagatgctgctgccgccgacccgttcgttg
gctcgcgccaagcgcagccttgcagggttgccgggtgggggcggtacgccattggcggcc
ggactcgatgcggccttcgtgctgtcggattcgatccgccgcaagggacagatgccgacg
gtgatcgtcctgaccgacggccgcgccaacattgcgcgcgatggcggacaggggcgtccg
cgtgccgaggacgacgcgatgagcgcggcgcggcagttgcgcgccgccggtattgcaatt
gtcctggtcgatacgtcgccgcgtcccggcgtttcaggcgaagctatcgccaaagagatg
ggcgcacgctatctgcctctgccgcatgcggacgccgcgaccttgtcaaaggccgtgctc
gcgagtgtcggctaa

DBGET integrated database retrieval system