KEGG   Bradyrhizobium sp. S23321: S23_19400Help
Entry
S23_19400         CDS       T01796                                 

Gene name
bchH
Definition
magnesium chelatase subunit BchH
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:brs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036887..2040558
Genome map
AA seq 1223 aa AA seqDB search
MDSHLSGAAARAQALLRSNFPGLSLTVHSADEWGTDDGALDRCKADIARGDIVIATMLFL
DDHVRAVMPALVARRGHCDAMICCMSAAEIVKLTRVGKFDMSGEALGAIAWLKKLRGNRK
GSPGGKGEMKMLRQLPKLLRFIPGTAQDMRAYFLTLQYWLAGSEQNIANMIRLLVDRYAE
GPRRSLRGIVKVEAPVDYADIGVYHPRLKGRITDTADRLPVLAGEHGTVGLLLLRSYLLA
GNAGHYDGVIAAFEARGLRVIPAFASGLDQRPAIERFFMKDGSSVVDAVVSLTGFSLVGG
PAYNDSRAAEDILAQLDVPYLSAHPVEFQTLEQWGASDRGLMPVESTIMVAIPELDGAAG
PMVYGGRSDGAGAPCTGCERACVFVPAETGGEMHVCSERADMLAARTARLVATRRSERQD
RKVAIVLFNFPPNAGNTGTAAFLSVFESLHRTLSVMKCEGYQVEVPETADALRERIVVGN
AARFGADANVHARISAGDHVRNEKWLRQIEAQWGPAPGKQQSDGSSIFVLGERFGNVFVG
IQPAFGYEGDPMRLLFEKGFAPTHAFSAFYRWLREDFGAGAVLHFGTHGALEFMPGKQAG
LSGACWPDRMIGDLPNLYLYASNNPSEGTIAKRRSAATLISYLTPPVAHAGLYKGLVELK
ASIERWRGLAPDEDAERGDLATLIQAQASALELTEAAPAWIDPATAVGKLSEAVLELEYT
LIPHGLHVVGETPSAEQRVEMLQAVADASHGVRPDKSILEALVTGEAPEALAARDAAALA
LYKELAGIDRILQQDHELPAILHALDGKFTRPAPGGDLLRTPAILPTGRNLHGFDPFRIP
SAFAVQDGAIQAQRLIDKHVGEGHGIPESVAIVLWGTDNLKNEGAPIGQALALLGAKPRF
DGYGRLTGAELVPLDQLNRPRIDVIITMSGIFRDLLPLQIKLLAEACFLAASADEPVERN
FVRKHALAFQAANHCDLETASLRVFGNADGAYGSNVNHLVENGRWDNEDELAETYTRRKS
FAYGLKGQPVQQMALLKNALATVDLAYQNLDSVELGVTTVDHYFDTLGGISRAVKMAKGG
RSAPVYIGDQTRGAGTVRTLSEQVSLETRTRMLNPKWYEGMLKHGYEGVRQIEEHVTNTM
GWSATTGEVAPWVYRQLTETFMLDPEMRERLASLNPVASAKVANRLIEAHERKYWSPDTE
MLDVLRRAGEELEDRLEGVGVAA
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atggacagtcacctgtccggtgcggctgcgcgtgcgcaggcgctgttaaggagtaacttc
ccggggctgtcgctcacggtgcattccgcagacgaatggggcactgacgacggagcgctc
gatcgctgcaaggccgatattgcccgcggcgacatcgtgatcgccaccatgctgtttctc
gacgatcacgttcgcgccgtgatgccggcgctcgttgcccggcgcggccattgcgacgcg
atgatctgttgcatgtcggcggccgaaatcgtcaagctgacacgcgtcggcaagttcgac
atgagcggcgaggcgctcggtgccatcgcgtggctcaagaagctgcgcggcaatcgcaag
ggcagccccggcggcaagggcgagatgaagatgctgcggcagctgcccaagctgctgcga
ttcatccccggcaccgctcaggacatgcgcgcctattttctgacgctgcaatactggctc
gccggctccgagcagaacatagcgaacatgatccgcctgctggtcgaccgttacgccgaa
ggtccccggcgcagcctgcgcggcatcgtcaaggtcgaggcgccggtcgactatgccgat
atcggcgtctaccatccgcgcctcaaggggcgcatcaccgataccgcagatcgactgccc
gtcctggccggcgagcacggcaccgtcggcctcctgttgctgcgctcctatctgctggcc
ggaaatgccggtcactatgacggtgtgatcgcggcgttcgaggcgagggggctgcgcgtg
atccccgcctttgccagtggcctcgaccagcggccggcgatcgaacgctttttcatgaag
gacggaagcagcgtggtcgatgcggtggtgtcgctcaccggcttctcgctagtgggcggt
cccgcctacaatgactcccgggccgccgaggacattttggctcaactcgacgtgccctat
ctgtcggcgcatcccgttgaattccagacgctggagcaatggggggcctcggatcgtggc
ctgatgccggtggagagcaccatcatggtggcgatccccgagctcgatggcgctgcggga
ccgatggtctatggcggtcgctccgacggggctggcgctccctgcaccggctgcgagcgg
gcctgtgttttcgtaccggccgagaccggcggcgaaatgcacgtgtgcagcgaacgcgcc
gacatgctggcggcgcgcactgcaaggctggtcgcgacgcgccgctccgaacggcaggat
cgcaaagtcgccatcgtcttgttcaatttcccgccgaatgccggcaacaccggcaccgcg
gcgtttttatcggtgttcgaatcgcttcatcgcacgctatccgtcatgaagtgcgagggc
tatcaggtcgaggtgcccgaaaccgccgacgctttgcgtgagcgtatcgtggtcggcaat
gccgcccgcttcggggctgatgccaacgtccacgccagaattagcgctggtgatcacgtt
cggaacgagaaatggctgcggcagatcgaggcgcaatgggggccggcgcctggcaagcag
cagagcgatggcagctcgatcttcgtgctaggtgagcgcttcggcaacgtcttcgtcggg
attcagcctgcattcggatatgaaggcgatccgatgcggctgttgttcgagaaaggcttt
gcgccgacgcatgccttctcggccttctatcgctggctgcgcgaggatttcggcgccggc
gcggtgctgcatttcggtacccatggcgcgcttgaattcatgccgggtaaacaggcgggg
ctttccggagcatgctggccggaccgcatgatcggcgacctgccgaacctctatctctat
gcctcgaacaacccgtccgaaggcacgatcgccaagcgtcgttcggccgcaacgctgatc
agctatctgacgccgccggtcgcgcatgccggactctacaagggactggttgagctgaag
gcctcgatcgagcgctggcgtggacttgctccggacgaagatgcggagcgcggcgatctc
gcaacattgattcaggctcaggccagtgcactggaactgaccgaggccgcccccgcctgg
attgatccggccacggcggtcggcaaattgtcggaagccgtgcttgagctcgaatacacg
ctgatcccgcatggtctgcatgtcgttggtgaaacgccgtcagccgagcagcgcgtcgag
atgcttcaggcggttgcggatgcctcgcatggcgtccgtccggacaaatccatcctcgag
gcgctggtgacgggcgaggcgcccgaagcattggccgcgagggacgctgccgcgctggcg
ctttacaaggagttggccggcatcgatcggatacttcagcaggatcacgaactgcccgcg
atcctgcatgcgctggacggcaagtttactcgtccggcgccggggggcgatctcctgcgc
acgccggccatcctgccgaccggccgcaatctccacggcttcgatccgttccgtattccc
agcgcctttgccgtgcaagacggcgcgattcaagcacagcggctgatcgacaagcacgtc
ggcgaaggacacggcatccccgaatccgtagcgatcgtgctgtggggcaccgataatctc
aagaacgagggcgcgccgatcgggcaggcgctggccttgcttggagcaaagccgcgcttc
gacggctatggccggctgactggcgcggaattggtcccgctcgatcagctcaaccggcca
cggatcgacgtgatcatcacgatgtccggcatcttccgggacctgctgccgctgcagatc
aagctcctggccgaagcctgcttcctggccgcatccgccgatgagccggtcgaacggaat
tttgtccgcaagcacgcgctggcgttccaggcagcaaatcattgcgacctggaaacggcg
tcgctgcgcgtgttcggcaatgccgacggcgcctatggctcgaacgtcaaccatctggtc
gaaaacggccgctgggacaacgaggacgaactggccgagacctatacccgccgcaagagc
tttgcttacggcctcaagggtcagccggtgcagcagatggcgctgttgaagaacgcgctc
gcaaccgtcgatctcgcttaccagaacctcgactcggtcgagctcggcgtgaccaccgtg
gatcactattttgacacgctgggcggcatcagccgcgccgtgaaaatggccaagggtggc
cggtcggcgccggtctatatcggcgaccagacccgcggcgccggcacggttcggacgctc
tcggagcaagtctcgctggaaacccgcacccggatgctcaatccgaaatggtacgaaggc
atgctcaagcacggctatgagggcgttcgccagatcgaggagcacgtcaccaacaccatg
ggctggtcggcgacgaccggcgaggtggcgccttgggtctatcggcagctcaccgagacc
ttcatgctcgatcccgaaatgcgcgagcgcctcgcctcgctcaatccggtggcctccgcg
aaggtcgcgaaccggctgatcgaggcacacgaacgcaaatactggtcgcccgatacggag
atgctcgatgtcctgcgcagggcaggcgaagagctcgaagaccgccttgaaggcgtggga
gttgccgcatga

DBGET integrated database retrieval system