KEGG   Bradyrhizobium sp. S23321: S23_21710Help
Entry
S23_21710         CDS       T01796                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S23_21710
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S23_21710
Enzymes [BR:brs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     S23_21710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2282396..2283373
Genome map
AA seq 325 aa AA seqDB search
MTDRIVTDRARRIALLGAPIDMGASQRGTLMGPAALRTAGLTTLLEGLDFEVVDYGDLSV
SEVRDLSDRPPGKANHYREIQRWTRVLSRRGYEIAKTGALPIFLGGDHSLSMGSVNAMAR
HWQERGRELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGDDPRASIDPD
RLDLFGARSIDKLEKELMRTRRIRVIDMRQIDEFGVAVLIRRVIERVNARNGVLHVSFDV
DFLDPSVAPGVGTTVPGGATYREAHLIMELLHDSGAVGSVDIVELNPFLDERGRTARTAV
ELIGSLFGQQITDRPTPSNAIAPGE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcggatcgtgacggatcgagcccggcgcatcgccttgctcggcgcgcctatc
gacatgggtgcttcgcaacgcggcaccttgatgggccccgcggcgctacgcaccgccggt
cttacgacgcttctggagggcctcgatttcgaggtcgtcgactacggtgatctttcggtc
tccgaggtccgggatctttccgaccggccgcctgggaaagccaatcactaccgcgaaatc
cagcgctggacgcgcgtgctaagccgcagaggctatgagatcgccaagaccggcgcgctg
ccgatcttcctcggcggcgatcactcgttgtcgatgggatcggtaaatgcgatggctcgg
cactggcaggagcgcggtcgagagctgttcgtgctctggctcgatgcgcatgccgattac
aatacgccggagacgacgatcacggccaacatgcacggcatgtccgcggcgttcctgtgc
ggcgagcccgggctcgacggattgctcggcgatgatccgcgtgcctcgatcgatcctgac
aggctcgatctgttcggggcgcgttcgatcgacaagctcgaaaaggagttgatgcgcacg
cgccggatcagggttatcgacatgcgccaaatcgacgagttcggcgtcgccgttctgatc
cgccgcgtcatcgaacgcgtcaacgcgcgcaacggcgtcctgcatgtcagcttcgatgtc
gactttctcgaccctagtgtggcccccggcgtcggcaccacggtaccgggaggcgcgact
tatcgcgaggcacatctaatcatggaattgctgcacgattccggcgcggtgggatcggtc
gacatcgtcgaactcaatccttttctcgatgagcgcggtcgcaccgcgcgcactgcagtc
gaactgatcggcagcttgttcggacagcagatcaccgaccgtccgacgcccagtaacgcg
atcgccccgggcgagtga

DBGET integrated database retrieval system