KEGG   Bradyrhizobium sp. S23321: S23_22060Help
Entry
S23_22060         CDS       T01796                                 

Definition
putative alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    S23_22060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_22060
  Lipid metabolism
   00071 Fatty acid degradation
    S23_22060
  Amino acid metabolism
   00350 Tyrosine metabolism
    S23_22060
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    S23_22060
   00626 Naphthalene degradation
    S23_22060
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     S23_22060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2319632..2320573)
Genome map
AA seq 313 aa AA seqDB search
MEERPDPVPGEGQIRVKITACGVCRTDLHLIDAELPDIRYPIVPGHEIIGRIDLVGPNVA
THAAGDRVGIPWLGFTCGHCRFCRKGMENLCDSPMFTGYTRDGGYATHTIADARYAFPLG
EAGNDVEMAPLLCAGLIGWRSLVLAGPAERLGLYGFGAAGHIIAQIAVWQGRSVYAFTRR
GDGAAQGLARRLGAAWVGASDEMPDEPLDAAIIYAPAGELVPAALRAVRKGGRVVCAGIH
MTDIPSFPYDLLWEERQLVSVANLTRQDGLDFLKIAPQAGVRTETTAFPLDQANEVLSML
RDGRILGAAVLTP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcggcccgatccggtgcccggcgaggggcagatccgggtgaagatcaccgct
tgcggggtgtgccggaccgatcttcacctcatcgacgccgagctgcctgatatccgctat
ccgatcgtgcccggccacgagatcattggccggattgatctcgtcggtcccaatgttgcg
acacatgcggccggcgaccgggtcggcattccctggctcggtttcacctgcggacactgt
cgattctgccggaaaggcatggaaaacctgtgtgacagcccgatgttcaccggctacacg
cgtgacggcggctacgcgacccacaccatcgccgatgcacgttatgcattcccgctcggc
gaggccggcaatgacgtggagatggctcctctgctgtgcgcagggctgatcggctggcgc
tcgctggtgctggccggacctgcggagaggttgggcctctacggtttcggcgccgccggc
cacatcatcgcgcagatcgcggtctggcaggggcgatccgtttatgcattcacgcgccgc
ggtgacggcgcagcacaaggtcttgcccgacgtctcggcgctgcctgggtgggagcttct
gacgaaatgcccgacgaaccgctcgacgccgccatcatctacgcaccggccggcgagctg
gtacccgccgcgctgcgcgccgtgcgcaaaggcggtcgcgtcgtgtgcgccggcatccac
atgaccgacattccgagttttccgtatgatctgctctgggaggagcggcagctggtctcg
gtcgccaatctgacccggcaggatggcctcgattttctcaagatcgctccgcaagccggc
gtgcgcaccgagacgacggcatttccgctcgaccaggccaacgaggttctgagcatgctg
cgcgatggccggattctcggcgcagccgtgctgacgccctga

DBGET integrated database retrieval system