KEGG   Bradyrhizobium sp. S23321: S23_25990Help
Entry
S23_25990         CDS       T01796                                 

Definition
putative Alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    S23_25990
  Lipid metabolism
   00561 Glycerolipid metabolism
    S23_25990
   00600 Sphingolipid metabolism
    S23_25990
Enzymes [BR:brs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     S23_25990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2727016..2728296
Genome map
AA seq 426 aa AA seqDB search
MAKPTKIVFLGASSASFGMSMFRDLFSTRDLAGSTLVLVGRNVDRLDRSTRLAKLLNAKS
GAGFEIEATTDWRAALDGAEFVVHSTAIDRNRLWRLDFEIPRKFGIHHTLGENGGPGGLF
FTLRTLPVVFDFVREMELRCPRATFINFSNPESRIILALGLYSRIRNLGLCHGIFLARGN
VARILGMPEDRVDVLGAGLNHFQCLSEIRDRETGEDLYPLLREKERDFDPTFCPLTRKLL
HAFGYWLGCGDSHVGEYLSFGWEAGEGGYDYDWDESERTKLTRLIDDVLAGRTEAPDWWS
VPSGERAISIIVAMVHNRKQLIESAVIHNRHVIPNLPADAAVEVPVVADIAGIHPVSLGP
LPDGVAKLMTVQVQVQQMAVEAAMHASKEMALQALLLDPVIHSEEAARGLLEELWEINRP
YIRACI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccaacgaagatcgtttttcttggcgcgagcagcgcatccttcgggatgagc
atgttccgggacctgttctcgacccgcgatttggccggttcaacattggtgctggtcgga
cgaaatgtcgaccggcttgaccggtcgacgcggctcgcgaaactgctcaacgcgaaatcc
ggcgccgggtttgagatcgaggcgacgacggattggcgcgcggcgctcgacggtgccgag
ttcgtcgtgcattccaccgcgatcgatcgcaatcggctgtggcggctcgatttcgagatt
ccacgaaagtttggcatccatcacacgctaggtgagaacggcggacccggaggtcttttc
ttcacactgcgcaccctgccggtggtcttcgacttcgtgcgagaaatggagctccgctgc
ccgcgcgcgaccttcatcaacttctccaatccggaaagtcgcatcatcctggcgctcggc
ctgtacagcaggattcgcaacctcggcctctgccacggaatatttcttgctcgcggcaat
gtcgcccgaattttgggaatgccggaagaccgggtggatgtgttgggggcaggcctcaat
cacttccaatgcttgagcgaaatacgagatcgtgagaccggcgaggacctctatccgctg
ttgcgtgagaaggagagggatttcgatcccaccttctgccccctgacgcgcaaattgttg
catgcctttggctactggctcggctgtggcgacagtcacgtgggcgagtatctctcgttc
ggatgggaggccggcgagggtggctacgattacgactgggacgagagcgaacgcacgaag
ctgacccggctgatcgatgacgtgctcgcaggccggaccgaggcgccggactggtggtcg
gtgccctcaggagagcgcgcgatcagcatcatagtcgccatggttcataaccgtaagcaa
ctcatcgagtccgccgtcattcacaatcggcacgtgatcccgaacctgccggccgatgct
gcggtcgaagtgccggtggtggcagatatcgcgggcatccaccctgtctcgctcgggccg
ctgcccgacggagtggccaagctgatgacggtccaggttcaggtccagcagatggccgtg
gaagcggcgatgcacgcatcgaaggaaatggcgctgcaagcgttgctgctcgaccctgtc
atccattccgaggaggccgcacgcggcctgctggaagagctgtgggagatcaaccgaccg
tacatccgggcatgcatctga

DBGET integrated database retrieval system