KEGG   Bradyrhizobium sp. S23321: S23_25990Help
Entry
S23_25990         CDS       T01796                                 

Definition
putative Alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:brs00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:brs00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:brs00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2727016..2728296
Genome map
AA seq 426 aa AA seqDB search
MAKPTKIVFLGASSASFGMSMFRDLFSTRDLAGSTLVLVGRNVDRLDRSTRLAKLLNAKS
GAGFEIEATTDWRAALDGAEFVVHSTAIDRNRLWRLDFEIPRKFGIHHTLGENGGPGGLF
FTLRTLPVVFDFVREMELRCPRATFINFSNPESRIILALGLYSRIRNLGLCHGIFLARGN
VARILGMPEDRVDVLGAGLNHFQCLSEIRDRETGEDLYPLLREKERDFDPTFCPLTRKLL
HAFGYWLGCGDSHVGEYLSFGWEAGEGGYDYDWDESERTKLTRLIDDVLAGRTEAPDWWS
VPSGERAISIIVAMVHNRKQLIESAVIHNRHVIPNLPADAAVEVPVVADIAGIHPVSLGP
LPDGVAKLMTVQVQVQQMAVEAAMHASKEMALQALLLDPVIHSEEAARGLLEELWEINRP
YIRACI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccaacgaagatcgtttttcttggcgcgagcagcgcatccttcgggatgagc
atgttccgggacctgttctcgacccgcgatttggccggttcaacattggtgctggtcgga
cgaaatgtcgaccggcttgaccggtcgacgcggctcgcgaaactgctcaacgcgaaatcc
ggcgccgggtttgagatcgaggcgacgacggattggcgcgcggcgctcgacggtgccgag
ttcgtcgtgcattccaccgcgatcgatcgcaatcggctgtggcggctcgatttcgagatt
ccacgaaagtttggcatccatcacacgctaggtgagaacggcggacccggaggtcttttc
ttcacactgcgcaccctgccggtggtcttcgacttcgtgcgagaaatggagctccgctgc
ccgcgcgcgaccttcatcaacttctccaatccggaaagtcgcatcatcctggcgctcggc
ctgtacagcaggattcgcaacctcggcctctgccacggaatatttcttgctcgcggcaat
gtcgcccgaattttgggaatgccggaagaccgggtggatgtgttgggggcaggcctcaat
cacttccaatgcttgagcgaaatacgagatcgtgagaccggcgaggacctctatccgctg
ttgcgtgagaaggagagggatttcgatcccaccttctgccccctgacgcgcaaattgttg
catgcctttggctactggctcggctgtggcgacagtcacgtgggcgagtatctctcgttc
ggatgggaggccggcgagggtggctacgattacgactgggacgagagcgaacgcacgaag
ctgacccggctgatcgatgacgtgctcgcaggccggaccgaggcgccggactggtggtcg
gtgccctcaggagagcgcgcgatcagcatcatagtcgccatggttcataaccgtaagcaa
ctcatcgagtccgccgtcattcacaatcggcacgtgatcccgaacctgccggccgatgct
gcggtcgaagtgccggtggtggcagatatcgcgggcatccaccctgtctcgctcgggccg
ctgcccgacggagtggccaagctgatgacggtccaggttcaggtccagcagatggccgtg
gaagcggcgatgcacgcatcgaaggaaatggcgctgcaagcgttgctgctcgaccctgtc
atccattccgaggaggccgcacgcggcctgctggaagagctgtgggagatcaaccgaccg
tacatccgggcatgcatctga

DBGET integrated database retrieval system