KEGG   Bradyrhizobium sp. S23321: S23_31190Help
Entry
S23_31190         CDS       T01796                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:brs00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:brs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3203362..3204309)
Genome map
AA seq 315 aa AA seqDB search
MTSKSTFVLGHRHLLGIEGLSAADITGLLDLSEEYVELNRQVDKKRTVLRGRTQVNLFFE
ASTRTQSSFELAGKRLGADVMNMSVSSSSIKKGETLVDTAMTLNAMHPDILVVRHHASGA
VELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRLEGLVVAICGDVLHSRVARSN
IILLNTMGARVRVVGPSTLLPPGIERMGVEVARDMREGLNGADIVMMLRLQRERMNGSFV
PSTSEYFHYFGLDQKKLAYAKPDALVMHPGPMNRGVEIDTAVADGAQSLIREQVEMGVAV
RMAVLEALARNLPNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaaatcgaccttcgtcctcggccaccggcatttgctgggcatcgagggcctt
tccgcggccgacatcaccggcctgctcgacctgtccgaagaatatgtcgagctcaaccgc
caggttgacaagaagcgcaccgtcctgcgtggacggacgcaggtgaacctgttcttcgag
gcctcgacccggacccagtcctcgttcgagctcgccggcaagcggctcggcgccgacgtc
atgaacatgtcggtgtcctcctcgtccatcaagaagggcgagacgctggtcgacaccgcg
atgacgctgaacgccatgcacccggatatcctggtggtccggcatcacgcctcgggcgcg
gtggaactgctggcccgcaaggtcgacggttccgtgatcaatgccggcgacggcgcgcac
gagcatccgacccaggcgctgctcgacgcgctcaccatccgccgcaacaagggccggctc
gagggcctcgtggtcgcaatctgcggcgacgtgctgcattcgcgcgtcgcccgctccaac
atcatcctgctcaacacgatgggcgcccgcgtccgcgtcgtcggcccctccaccctgctg
ccgcccggcatcgagcggatgggcgtcgaggtggcgcgcgacatgcgcgagggcctcaac
ggcgccgacatcgtcatgatgctgcggctgcagcgcgagcgcatgaacggctccttcgtg
ccgtcgacctcggaatatttccactatttcgggctcgaccagaagaagctcgcttacgcc
aagccggacgcgctcgtgatgcatcccggccccatgaaccgcggcgtcgagatcgacacc
gcggtcgccgacggcgcgcaatcgctgatccgcgaacaggtggagatgggcgtggccgtg
cgcatggccgtgctcgaagcgctcgcccgcaatttgccgaacgcgtga

DBGET integrated database retrieval system