KEGG   Bradyrhizobium sp. S23321: S23_31710Help
Entry
S23_31710         CDS       T01796                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S23_31710
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     S23_31710
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S23_31710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3256775..3257836)
Genome map
AA seq 353 aa AA seqDB search
MAIKYGRPIELREVSRGTGAGASPALDLTIRPRRNRKAEWARRMVRENVLTTDDLIWPLF
LIDGNNRREQIASMPGVDRLSVDQAVREAERAMKLTIPCIALFPYTDPSLRDEEGSEATN
PNNLVCQAVRAIKKEFPEIGVLCDVALDPFTSHGHDGLITDGKILNDETVAVLVRQALVQ
AEAGCDIIAPSDMMDGRVAAIREGLDRSGLLDVQIMAYAAKYASAFYGPFRDAIGSAKTL
TGDKRTYQMDSANTDEALREVELDIAEGADMVMVKPGMPYLDVVRRVKDTFAMPTFAYQV
SGEYAMIAAAANNGWLDGERAMMESLLAFKRAGADGVLSYFAPKAAEKLRAQG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaatacggacgtccgatcgaattgcgcgaggtttcgcgcgggaccggcgcg
ggagcttcccctgccctcgatctgaccatccgtccgcgccgcaaccgcaaggccgaatgg
gcccggcgcatggtgcgtgagaacgtgctcaccaccgacgatctgatctggccgctgttc
ctgatcgacggcaacaacaggcgagagcagatcgcctcgatgccgggcgtcgaccgcctc
agcgtcgaccaggccgtgcgcgaggccgagcgcgccatgaagctcaccattccctgcatc
gcgctgtttccctacaccgatccgtccctgcgcgacgaggaaggctcggaagcgaccaat
ccgaacaatctggtttgccaggcggtgcgcgcgatcaagaaggagtttcccgagatcggc
gtcctctgcgacgtcgcgctcgatcccttcaccagccacggccacgatggcctgatcacc
gacggcaagatcctgaacgacgagacggtcgccgtgctggtgcgtcaggcgctggtgcag
gccgaagccggctgcgacatcatcgcgccctccgacatgatggacggccgcgtcgccgcg
atccgcgaaggcctggaccgctcaggtctcctcgacgtgcagatcatggcctatgcggcc
aaatacgcttccgctttctatggcccgttccgcgacgccatcggctcggccaagacgctc
accggcgacaagcgcacctaccagatggacagcgccaacaccgacgaagccctgcgcgag
gtcgagctcgacatagccgaaggtgccgacatggtgatggtgaagccgggcatgccctat
ctcgacgtggtccgccgcgtgaaggacacgttcgcgatgccgaccttcgcctaccaggtg
tccggcgaatacgcgatgatcgcggcggccgccaacaacggctggctcgacggcgagcgc
gcgatgatggagagcctgctcgccttcaagcgcgccggcgccgacggcgtgctcagctat
ttcgcgccgaaggcggcggagaagctgcgggcgcaggggtag

DBGET integrated database retrieval system