KEGG   Bradyrhizobium sp. S23321: S23_33330Help
Entry
S23_33330         CDS       T01796                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S23_33330 (dxr)
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     S23_33330 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3417600..3418823
Genome map
AA seq 407 aa AA seqDB search
MSAVPLRNNKAAASAVRSVTVLGATGSIGDSTMDLLRASPERYRVEALTANSNVEALAKL
AREFSARFVAIADTSKLAELKSALAGTSTECGAGESAVIEAGARPADWVMAAVSGAAGLK
PALAAVDRGAHVALANKECLVCAGDFFMQRAAKAGACILPADSEHNALFQALASGNRDEL
VRVIITASGGPFRTWKPADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYL
FALSPDEIDVLVHPQSIIHGMVEFSDCSVVAQLGAPDMRTPIAHCLGWPDRIKGPAAKLD
LAKIGQLTFEAPDFERFPGLRLAYDSLRTGKGATTVYNAANEVAVAAFIAGKIRFGAIAR
LVETTLDDWIRGGNQIPLTSADDAISVDHVARNRAAALLPQIALKAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtcccattgcgtaacaacaaggctgcggcgtctgccgtccgcagcgtcacg
gttctcggcgccaccggctcgatcggcgacagcacgatggatctgctgcgcgcctccccc
gagcgctaccgggtcgaagccctcacggcgaacagcaatgtcgaggcgctggccaagctc
gccagggaattttccgcgcgtttcgtcgcgatcgccgacacctccaagctcgccgagctg
aagtctgcactggcgggcacgagcaccgaatgcggggccggtgaaagcgcggtgatcgaa
gccggcgcgcggccggccgactgggtgatggcggccgtcagcggcgctgccggcctgaag
cccgcactcgccgcggtggatcgcggcgcgcatgtcgcgctggcgaacaaggaatgcctc
gtttgcgccggcgacttcttcatgcagcgcgcagcgaaagcgggcgcctgcatcctgccg
gccgattccgagcacaatgcgctgttccaggcgctcgcctcgggcaatcgtgacgaactc
gttcgcgtcatcatcacggcatccggcggcccgttccgcacctggaagcctgccgacatc
gagcaggccacgctggcccaggcgctgaagcatccgaactggagcatgggccagaagatc
acgatcgattccgcctcgatgatgaacaagggcctcgaagtgatcgaggcgtcctacctg
ttcgcgctgagcccggacgagatcgacgtgctggttcatccgcagtcgatcatccacggc
atggtcgaattctcggattgttcggtcgtggcccagctcggcgcccctgacatgcgcacg
ccgatcgcgcactgcctgggctggccggaccggatcaagggacccgccgccaagctggat
ctcgccaagatcggccaattgaccttcgaggcgccggatttcgagcgcttccccggcctg
cgcctcgcctacgattcgctccggaccgggaagggggcgaccaccgtctacaacgctgcc
aacgaggtcgcggtcgcagccttcattgccggcaagatccggttcggcgcgatcgcgcgg
ttggtcgagacgacgctggacgactggatccggggcgggaaccagatcccgctgacgtca
gccgacgatgcaatctctgttgaccatgttgcgcgaaatagagctgccgccctattgcct
caaattgccttaaaggcatcctag

DBGET integrated database retrieval system